Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W1T3

Protein Details
Accession A0A2N5W1T3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
36-65LDSKVLPIPPRQKIKRHRRRQSVFHNELSSHydrophilic
NLS Segment(s)
PositionSequence
46-55RQKIKRHRRR
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTAMNLALSLDCSFLDLSNDDPAYDSPTSSQEDEPLDSKVLPIPPRQKIKRHRRRQSVFHNELSSRPYSLSSSCSGRSRHRSCESGSLLNLSDIYLPLENCDHWSMSGSVNYVVQRPIASSSSSYPSSLRTIYDQCENSSESYAVLQTTSLTHGSPSREPEKAAAGKMHPSNFTTSASIELPRNSKKHAPHHYPSKSDRNAIFPPLENDTLLPAANHLDHMMGEAARMPKLKRTDSGINGSCSIKLVSSFALPEKSSSLQVESAENLNSAANFEIVISSGPLANIDPNQPLPTTLPLKLKSSGTKDKQPGSKTDFLSQKNVAWVSNLSDGKENRVDGFHVISEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.11
4 0.12
5 0.17
6 0.18
7 0.16
8 0.17
9 0.17
10 0.21
11 0.2
12 0.19
13 0.15
14 0.18
15 0.22
16 0.23
17 0.23
18 0.22
19 0.24
20 0.26
21 0.26
22 0.25
23 0.22
24 0.2
25 0.2
26 0.2
27 0.23
28 0.24
29 0.31
30 0.38
31 0.45
32 0.56
33 0.62
34 0.67
35 0.73
36 0.81
37 0.84
38 0.86
39 0.89
40 0.89
41 0.91
42 0.92
43 0.92
44 0.92
45 0.87
46 0.82
47 0.76
48 0.66
49 0.59
50 0.53
51 0.43
52 0.33
53 0.27
54 0.22
55 0.19
56 0.19
57 0.2
58 0.2
59 0.22
60 0.24
61 0.29
62 0.31
63 0.38
64 0.47
65 0.49
66 0.55
67 0.57
68 0.57
69 0.55
70 0.6
71 0.56
72 0.49
73 0.44
74 0.37
75 0.32
76 0.28
77 0.26
78 0.16
79 0.12
80 0.09
81 0.1
82 0.09
83 0.08
84 0.09
85 0.1
86 0.1
87 0.12
88 0.13
89 0.12
90 0.11
91 0.13
92 0.13
93 0.13
94 0.15
95 0.13
96 0.12
97 0.14
98 0.14
99 0.14
100 0.13
101 0.12
102 0.11
103 0.11
104 0.13
105 0.12
106 0.12
107 0.12
108 0.14
109 0.17
110 0.18
111 0.18
112 0.16
113 0.17
114 0.18
115 0.18
116 0.16
117 0.16
118 0.17
119 0.19
120 0.24
121 0.23
122 0.22
123 0.23
124 0.23
125 0.2
126 0.19
127 0.17
128 0.11
129 0.11
130 0.1
131 0.08
132 0.07
133 0.06
134 0.05
135 0.05
136 0.07
137 0.07
138 0.06
139 0.07
140 0.1
141 0.13
142 0.14
143 0.18
144 0.2
145 0.2
146 0.21
147 0.21
148 0.24
149 0.24
150 0.23
151 0.2
152 0.18
153 0.22
154 0.24
155 0.24
156 0.19
157 0.18
158 0.2
159 0.19
160 0.19
161 0.16
162 0.14
163 0.14
164 0.14
165 0.14
166 0.13
167 0.14
168 0.16
169 0.2
170 0.21
171 0.22
172 0.27
173 0.32
174 0.41
175 0.48
176 0.52
177 0.55
178 0.64
179 0.66
180 0.67
181 0.66
182 0.66
183 0.59
184 0.56
185 0.5
186 0.46
187 0.43
188 0.39
189 0.35
190 0.26
191 0.26
192 0.24
193 0.23
194 0.17
195 0.15
196 0.14
197 0.13
198 0.12
199 0.09
200 0.06
201 0.07
202 0.07
203 0.07
204 0.06
205 0.06
206 0.05
207 0.06
208 0.07
209 0.06
210 0.05
211 0.08
212 0.09
213 0.1
214 0.13
215 0.12
216 0.17
217 0.23
218 0.25
219 0.24
220 0.3
221 0.36
222 0.39
223 0.47
224 0.45
225 0.42
226 0.41
227 0.4
228 0.33
229 0.26
230 0.22
231 0.14
232 0.11
233 0.1
234 0.09
235 0.09
236 0.1
237 0.11
238 0.14
239 0.14
240 0.14
241 0.16
242 0.17
243 0.18
244 0.18
245 0.18
246 0.17
247 0.18
248 0.18
249 0.17
250 0.17
251 0.15
252 0.14
253 0.13
254 0.11
255 0.1
256 0.09
257 0.08
258 0.07
259 0.06
260 0.06
261 0.06
262 0.06
263 0.06
264 0.05
265 0.05
266 0.06
267 0.06
268 0.06
269 0.07
270 0.08
271 0.1
272 0.12
273 0.14
274 0.15
275 0.16
276 0.16
277 0.17
278 0.17
279 0.22
280 0.24
281 0.26
282 0.32
283 0.33
284 0.37
285 0.39
286 0.41
287 0.42
288 0.47
289 0.52
290 0.52
291 0.59
292 0.62
293 0.67
294 0.7
295 0.66
296 0.66
297 0.64
298 0.65
299 0.59
300 0.6
301 0.6
302 0.56
303 0.59
304 0.53
305 0.47
306 0.46
307 0.44
308 0.36
309 0.3
310 0.28
311 0.26
312 0.32
313 0.3
314 0.26
315 0.31
316 0.32
317 0.36
318 0.39
319 0.36
320 0.29
321 0.3
322 0.3
323 0.25
324 0.28
325 0.23