Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5TPP4

Protein Details
Accession A0A2N5TPP4    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-71SAPVGKPKVHRGGRRRSPPKILLBasic
NLS Segment(s)
PositionSequence
53-67GKPKVHRGGRRRSPP
Subcellular Location(s) mito 15, cyto 7, nucl 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSPFPGYALVEYKNRKNAKVAISTGTDSKLLDQTLKCNFVFVRAPAGASAPVGKPKVHRGGRRRSPPKILLVNCID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.44
4 0.47
5 0.46
6 0.48
7 0.45
8 0.39
9 0.39
10 0.38
11 0.34
12 0.29
13 0.23
14 0.16
15 0.15
16 0.14
17 0.12
18 0.13
19 0.13
20 0.16
21 0.19
22 0.22
23 0.2
24 0.19
25 0.19
26 0.19
27 0.2
28 0.16
29 0.18
30 0.15
31 0.15
32 0.14
33 0.15
34 0.12
35 0.1
36 0.12
37 0.08
38 0.12
39 0.13
40 0.14
41 0.16
42 0.24
43 0.34
44 0.4
45 0.48
46 0.53
47 0.63
48 0.72
49 0.81
50 0.82
51 0.8
52 0.81
53 0.78
54 0.78
55 0.77
56 0.69