Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VTI4

Protein Details
Accession A0A2N5VTI4   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MEVRPPKRVMWPQQRYWRKTKRPALAQAWFKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 9.333, nucl 8.5, cyto_nucl 8.333, cyto 7
Family & Domain DBs
Amino Acid Sequences MEVRPPKRVMWPQQRYWRKTKRPALAQAWFKEHKRTGPMSRISPQRFPELLETTGPLLMLGNLLTGIVLDVEQACKRAFCGVIVEHVSGHLFRGITAEQEYYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.83
4 0.83
5 0.82
6 0.84
7 0.84
8 0.83
9 0.82
10 0.85
11 0.83
12 0.8
13 0.77
14 0.7
15 0.67
16 0.62
17 0.54
18 0.52
19 0.46
20 0.41
21 0.39
22 0.42
23 0.41
24 0.44
25 0.48
26 0.45
27 0.49
28 0.54
29 0.52
30 0.51
31 0.47
32 0.45
33 0.4
34 0.37
35 0.36
36 0.3
37 0.27
38 0.22
39 0.21
40 0.15
41 0.15
42 0.13
43 0.09
44 0.06
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.02
53 0.03
54 0.02
55 0.02
56 0.03
57 0.03
58 0.05
59 0.06
60 0.08
61 0.08
62 0.08
63 0.09
64 0.11
65 0.12
66 0.11
67 0.14
68 0.14
69 0.19
70 0.21
71 0.21
72 0.18
73 0.18
74 0.18
75 0.14
76 0.15
77 0.12
78 0.09
79 0.09
80 0.12
81 0.12
82 0.14
83 0.16