Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W0A9

Protein Details
Accession A0A2N5W0A9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MHKAQKESGKNKKRKRKPSIPPTSDKEPBasic
NLS Segment(s)
PositionSequence
6-19KESGKNKKRKRKPS
Subcellular Location(s) nucl 20.5, mito_nucl 13.166, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MHKAQKESGKNKKRKRKPSIPPTSDKEPAWPDSPASESNPREALEHESFVGGINFTTGVVPKHNNMGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.91
4 0.92
5 0.93
6 0.94
7 0.9
8 0.87
9 0.82
10 0.78
11 0.71
12 0.6
13 0.54
14 0.45
15 0.41
16 0.35
17 0.29
18 0.23
19 0.19
20 0.21
21 0.18
22 0.18
23 0.22
24 0.2
25 0.22
26 0.23
27 0.23
28 0.21
29 0.22
30 0.25
31 0.2
32 0.21
33 0.19
34 0.17
35 0.17
36 0.16
37 0.15
38 0.08
39 0.06
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.08
46 0.12
47 0.15
48 0.16