Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5U8Z4

Protein Details
Accession A0A2N5U8Z4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-42NQPSSKQASKMPKRRKKQLSTELKAHydrophilic
NLS Segment(s)
PositionSequence
27-34KMPKRRKK
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences MPVQQRQRRVQTAQLNSNQPSSKQASKMPKRRKKQLSTELKARIVGLSEAGMARSAIARKFGMVRQTVSGIVTRFSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.58
4 0.59
5 0.51
6 0.42
7 0.39
8 0.36
9 0.33
10 0.31
11 0.36
12 0.42
13 0.51
14 0.61
15 0.67
16 0.71
17 0.76
18 0.83
19 0.86
20 0.84
21 0.84
22 0.84
23 0.84
24 0.8
25 0.79
26 0.73
27 0.64
28 0.56
29 0.45
30 0.35
31 0.25
32 0.19
33 0.12
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.07
42 0.09
43 0.09
44 0.12
45 0.12
46 0.13
47 0.16
48 0.19
49 0.24
50 0.24
51 0.26
52 0.26
53 0.27
54 0.27
55 0.25
56 0.25
57 0.2