Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5S9L3

Protein Details
Accession A0A2N5S9L3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPRHRSCVFNQPCRKKKRTGPSFSEQLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MPRHRSCVFNQPCRKKKRTGPSFSEQLFELDCLDEVARQVQYQSEVPHADGGSGKPPPNSDEDKQHVDPWEDQEEQPLPNLPENHQLPTPGSAPLLSSISDYYQTVQQQRLAAQTLLNWARSAQRFRFANAVQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.82
4 0.82
5 0.83
6 0.81
7 0.8
8 0.78
9 0.81
10 0.72
11 0.64
12 0.53
13 0.44
14 0.34
15 0.27
16 0.19
17 0.11
18 0.1
19 0.09
20 0.09
21 0.08
22 0.07
23 0.09
24 0.09
25 0.08
26 0.09
27 0.09
28 0.11
29 0.13
30 0.14
31 0.15
32 0.15
33 0.15
34 0.17
35 0.16
36 0.14
37 0.13
38 0.12
39 0.12
40 0.14
41 0.14
42 0.13
43 0.14
44 0.15
45 0.19
46 0.23
47 0.22
48 0.27
49 0.3
50 0.35
51 0.35
52 0.36
53 0.33
54 0.29
55 0.28
56 0.25
57 0.25
58 0.2
59 0.19
60 0.2
61 0.2
62 0.18
63 0.17
64 0.16
65 0.13
66 0.15
67 0.16
68 0.15
69 0.22
70 0.23
71 0.25
72 0.23
73 0.23
74 0.21
75 0.22
76 0.22
77 0.14
78 0.13
79 0.11
80 0.11
81 0.12
82 0.11
83 0.09
84 0.09
85 0.09
86 0.1
87 0.11
88 0.11
89 0.11
90 0.14
91 0.17
92 0.2
93 0.22
94 0.24
95 0.25
96 0.26
97 0.27
98 0.26
99 0.23
100 0.2
101 0.19
102 0.24
103 0.24
104 0.24
105 0.21
106 0.19
107 0.26
108 0.31
109 0.38
110 0.32
111 0.39
112 0.4
113 0.42
114 0.5