Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5THK4

Protein Details
Accession A0A2N5THK4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22LQAVRLKRYSYRRRGNFDLHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMLQAVRLKRYSYRRRGNFDLHLLRLYVGMYTADCMTFRVVLPSELACRQLYQRYGASANLASLLDHAACTLGERTTPVSSVPLAPVSAPSAAELVDNFSLHRLPQLYAELVRSHNLAVVVEPPAAYKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.8
4 0.8
5 0.75
6 0.74
7 0.7
8 0.61
9 0.53
10 0.46
11 0.39
12 0.32
13 0.25
14 0.15
15 0.09
16 0.07
17 0.06
18 0.07
19 0.07
20 0.07
21 0.07
22 0.08
23 0.08
24 0.09
25 0.09
26 0.1
27 0.1
28 0.11
29 0.12
30 0.12
31 0.14
32 0.13
33 0.15
34 0.13
35 0.13
36 0.14
37 0.17
38 0.18
39 0.18
40 0.18
41 0.18
42 0.19
43 0.18
44 0.18
45 0.14
46 0.12
47 0.1
48 0.09
49 0.07
50 0.06
51 0.06
52 0.05
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.05
59 0.05
60 0.05
61 0.06
62 0.08
63 0.08
64 0.09
65 0.08
66 0.09
67 0.09
68 0.1
69 0.1
70 0.09
71 0.09
72 0.08
73 0.09
74 0.09
75 0.09
76 0.08
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.09
84 0.09
85 0.08
86 0.09
87 0.1
88 0.09
89 0.13
90 0.11
91 0.11
92 0.14
93 0.17
94 0.18
95 0.18
96 0.21
97 0.2
98 0.2
99 0.21
100 0.19
101 0.16
102 0.16
103 0.15
104 0.13
105 0.12
106 0.13
107 0.13
108 0.13
109 0.12