FuNGI

A0A2N5STR9

Protein Details

Accession

A0A2N5STR9

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
8-35	VSNPATAHESRQRQRKKPMYSYDPNSDL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 8.5, plas 7, cyto_mito 5, nucl 3, E.R. 3, golg 3

Family & Domain DBs

InterPro	View protein in InterPro IPR015876 Acyl-CoA_DS IPR001199 Cyt_B5-like_heme/steroid-bd IPR036400 Cyt_B5-like_heme/steroid_sf IPR018506 Cyt_B5_heme-BS
Gene Ontology	GO:0016020 C:membrane GO:0020037 F:heme binding GO:0046872 F:metal ion binding GO:0016717 F:oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
Pfam	View protein in Pfam PF00173 Cyt-b5
PROSITE	View protein in PROSITE PS00191 CYTOCHROME_B5_1 PS50255 CYTOCHROME_B5_2
CDD	cd03505 Delta9-FADS-like

Amino Acid Sequences

MMSNSISVSNPATAHESRQRQRKKPMYSYDPNSDLSESEGSSDPKCQSGNTCDDNERTDVDHDKLSSHAHFHSLHSAHLASGKATPPNHLAQFLSRDQCGFHPSFNYHPSHYHLWCLHHTSLSSNLSLVYHLLLFHRHMGWMIVKPRRKPGAADVSDLACNQVVRWQHRWYLPLIDLMGFIFATLVTGLGWGDWRGGFFYAGAAPLLFIHHITFCVNSLAHWLGEASFDDKHTPRDHIITAFLTIGEGYYNFHHEFPQDFRNGIRWYQFDPTKWFIILTAFLGFASELKTFPDNEVRKGQYNMKLKELKRDFKDVKWPKDSNDLPILSWDKYVEEANREGGRKLIVVGGFIHDVTKFINEHPGGQAIIGMQLGKDATTAFHGGVYDHSNAAHNLLAMYRVGAIEGGYEVEHLEKKIGIFQKEHKIPICGPNSLGMPNTDIPDVGVKSI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.28
2	0.35
3	0.43
4	0.48
5	0.59
6	0.67
7	0.7
8	0.8
9	0.83
10	0.84
11	0.84
12	0.87
13	0.87
14	0.86
15	0.85
16	0.82
17	0.76
18	0.68
19	0.6
20	0.5
21	0.41
22	0.34
23	0.28
24	0.2
25	0.19
26	0.2
27	0.2
28	0.2
29	0.24
30	0.22
31	0.23
32	0.24
33	0.22
34	0.25
35	0.3
36	0.37
37	0.37
38	0.4
39	0.41
40	0.42
41	0.44
42	0.39
43	0.34
44	0.28
45	0.27
46	0.27
47	0.25
48	0.27
49	0.24
50	0.23
51	0.23
52	0.24
53	0.23
54	0.22
55	0.21
56	0.22
57	0.23
58	0.24
59	0.31
60	0.28
61	0.27
62	0.26
63	0.26
64	0.21
65	0.23
66	0.22
67	0.14
68	0.16
69	0.18
70	0.21
71	0.21
72	0.24
73	0.24
74	0.29
75	0.3
76	0.28
77	0.27
78	0.25
79	0.3
80	0.32
81	0.31
82	0.26
83	0.25
84	0.25
85	0.25
86	0.28
87	0.23
88	0.2
89	0.21
90	0.23
91	0.28
92	0.32
93	0.33
94	0.29
95	0.3
96	0.34
97	0.37
98	0.35
99	0.36
100	0.34
101	0.35
102	0.37
103	0.4
104	0.36
105	0.31
106	0.31
107	0.26
108	0.29
109	0.27
110	0.24
111	0.18
112	0.17
113	0.16
114	0.15
115	0.14
116	0.08
117	0.07
118	0.07
119	0.07
120	0.09
121	0.1
122	0.12
123	0.12
124	0.11
125	0.11
126	0.13
127	0.14
128	0.18
129	0.24
130	0.3
131	0.34
132	0.37
133	0.45
134	0.48
135	0.47
136	0.44
137	0.46
138	0.49
139	0.46
140	0.46
141	0.39
142	0.36
143	0.35
144	0.32
145	0.24
146	0.13
147	0.11
148	0.09
149	0.11
150	0.14
151	0.18
152	0.22
153	0.25
154	0.29
155	0.32
156	0.34
157	0.32
158	0.31
159	0.27
160	0.24
161	0.22
162	0.17
163	0.15
164	0.13
165	0.12
166	0.07
167	0.06
168	0.04
169	0.03
170	0.03
171	0.03
172	0.03
173	0.03
174	0.03
175	0.03
176	0.03
177	0.04
178	0.03
179	0.04
180	0.04
181	0.05
182	0.05
183	0.06
184	0.06
185	0.05
186	0.06
187	0.06
188	0.06
189	0.06
190	0.05
191	0.04
192	0.04
193	0.05
194	0.04
195	0.04
196	0.04
197	0.05
198	0.05
199	0.06
200	0.06
201	0.06
202	0.07
203	0.07
204	0.06
205	0.09
206	0.09
207	0.08
208	0.08
209	0.08
210	0.06
211	0.07
212	0.07
213	0.06
214	0.06
215	0.07
216	0.09
217	0.1
218	0.13
219	0.14
220	0.16
221	0.16
222	0.18
223	0.19
224	0.17
225	0.18
226	0.15
227	0.15
228	0.12
229	0.11
230	0.08
231	0.07
232	0.06
233	0.04
234	0.04
235	0.04
236	0.05
237	0.08
238	0.09
239	0.1
240	0.1
241	0.11
242	0.13
243	0.16
244	0.2
245	0.18
246	0.17
247	0.17
248	0.23
249	0.24
250	0.23
251	0.23
252	0.2
253	0.22
254	0.27
255	0.29
256	0.26
257	0.3
258	0.31
259	0.29
260	0.27
261	0.25
262	0.19
263	0.18
264	0.16
265	0.12
266	0.09
267	0.08
268	0.08
269	0.08
270	0.07
271	0.06
272	0.08
273	0.07
274	0.07
275	0.08
276	0.1
277	0.1
278	0.12
279	0.21
280	0.21
281	0.24
282	0.31
283	0.32
284	0.34
285	0.37
286	0.42
287	0.41
288	0.48
289	0.46
290	0.48
291	0.53
292	0.51
293	0.58
294	0.6
295	0.6
296	0.54
297	0.62
298	0.57
299	0.54
300	0.64
301	0.63
302	0.63
303	0.64
304	0.61
305	0.54
306	0.61
307	0.58
308	0.52
309	0.5
310	0.42
311	0.33
312	0.37
313	0.37
314	0.28
315	0.27
316	0.22
317	0.15
318	0.16
319	0.18
320	0.15
321	0.16
322	0.17
323	0.21
324	0.25
325	0.26
326	0.25
327	0.23
328	0.22
329	0.19
330	0.18
331	0.17
332	0.13
333	0.12
334	0.13
335	0.14
336	0.13
337	0.13
338	0.13
339	0.09
340	0.09
341	0.09
342	0.11
343	0.1
344	0.1
345	0.19
346	0.18
347	0.2
348	0.21
349	0.22
350	0.2
351	0.19
352	0.19
353	0.1
354	0.11
355	0.09
356	0.08
357	0.06
358	0.07
359	0.07
360	0.06
361	0.06
362	0.05
363	0.06
364	0.09
365	0.1
366	0.09
367	0.1
368	0.1
369	0.11
370	0.13
371	0.16
372	0.14
373	0.14
374	0.14
375	0.15
376	0.15
377	0.16
378	0.14
379	0.11
380	0.1
381	0.1
382	0.11
383	0.09
384	0.09
385	0.08
386	0.07
387	0.07
388	0.07
389	0.06
390	0.06
391	0.06
392	0.07
393	0.06
394	0.06
395	0.06
396	0.09
397	0.11
398	0.11
399	0.12
400	0.12
401	0.13
402	0.21
403	0.27
404	0.28
405	0.31
406	0.38
407	0.48
408	0.52
409	0.57
410	0.52
411	0.51
412	0.52
413	0.56
414	0.53
415	0.45
416	0.4
417	0.38
418	0.37
419	0.34
420	0.31
421	0.23
422	0.23
423	0.23
424	0.25
425	0.21
426	0.19
427	0.18
428	0.22

A0A2N5STR9

3D AlphaFold-predicted Structure Viewer