Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NFG7

Protein Details
Accession J3NFG7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-79YSTPIPPRKKTPPKKLYTRSPIPFHydrophilic
NLS Segment(s)
PositionSequence
63-70RKKTPPKK
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MLRNIAPPSHASLKHQGVRNITLPTTIGTATTQNVPADDMASERSLPINELCNGPYSTPIPPRKKTPPKKLYTRSPIPFKLRLHRREQGQCCIRTEKVIKMHGSSRSKLGFSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.51
4 0.48
5 0.51
6 0.49
7 0.44
8 0.36
9 0.3
10 0.25
11 0.22
12 0.19
13 0.14
14 0.11
15 0.09
16 0.1
17 0.11
18 0.12
19 0.13
20 0.12
21 0.12
22 0.12
23 0.11
24 0.1
25 0.09
26 0.08
27 0.07
28 0.08
29 0.08
30 0.07
31 0.08
32 0.08
33 0.08
34 0.09
35 0.1
36 0.11
37 0.12
38 0.12
39 0.13
40 0.14
41 0.13
42 0.13
43 0.12
44 0.13
45 0.2
46 0.29
47 0.33
48 0.35
49 0.42
50 0.51
51 0.61
52 0.69
53 0.72
54 0.74
55 0.75
56 0.83
57 0.85
58 0.84
59 0.83
60 0.82
61 0.77
62 0.75
63 0.73
64 0.69
65 0.68
66 0.62
67 0.63
68 0.63
69 0.63
70 0.63
71 0.62
72 0.65
73 0.69
74 0.7
75 0.7
76 0.69
77 0.65
78 0.62
79 0.61
80 0.53
81 0.5
82 0.48
83 0.45
84 0.44
85 0.47
86 0.45
87 0.44
88 0.49
89 0.51
90 0.53
91 0.48
92 0.48
93 0.45