Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5T3Y7

Protein Details
Accession A0A2N5T3Y7   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
395-414DSSTSNTRRFVKRSRTTWKKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, nucl 3.5, cyto_nucl 2.5, mito 2, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021476  Egh16-like  
Pfam View protein in Pfam  
PF11327  Egh16-like  
Amino Acid Sequences MTIGEKESRSWSSSPSASPSSLHKASLDPLYLSMPSLAASLVGLALITQAAAHLSLINIYGANNAVGHAFGVNLQGKYPRARGEDGDAGGDSGIFQTGTDTPSPACGSTPELGEVDVTAWLSQAEGEGLPSAYANMSVVVEAFQVNRDGGGPMSCEYSDDANATSWKPMSMTLNQAGTAGIYNQVRTNETVVMNFPSDAQCTGGWTQTACIVRCRTGVNKRFGGCFAVKLNGATERTMRVSDSNATSDTSTVVRAVANATALTTDLSNDQMVLLANQVITKIKQEDLVFSSASANNTASSLASSSTTNSSTLDESDLVDNEQMGLFTNQVIIQMKKEGIVLSSASANNTASNLAQAATNNQLDTNNSTTDDSTLDNSDLADSQLYNNSAQTSDSDSSTSNTRRFVKRSRTTWKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.37
4 0.34
5 0.35
6 0.37
7 0.39
8 0.37
9 0.35
10 0.3
11 0.29
12 0.31
13 0.34
14 0.3
15 0.22
16 0.22
17 0.23
18 0.22
19 0.2
20 0.17
21 0.12
22 0.11
23 0.1
24 0.09
25 0.06
26 0.06
27 0.05
28 0.05
29 0.04
30 0.04
31 0.03
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.06
56 0.05
57 0.05
58 0.1
59 0.14
60 0.13
61 0.14
62 0.18
63 0.2
64 0.24
65 0.27
66 0.28
67 0.29
68 0.31
69 0.32
70 0.36
71 0.38
72 0.35
73 0.33
74 0.27
75 0.23
76 0.2
77 0.18
78 0.11
79 0.06
80 0.06
81 0.04
82 0.04
83 0.06
84 0.07
85 0.09
86 0.1
87 0.1
88 0.1
89 0.13
90 0.14
91 0.13
92 0.12
93 0.11
94 0.14
95 0.15
96 0.16
97 0.15
98 0.14
99 0.13
100 0.13
101 0.12
102 0.09
103 0.07
104 0.07
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.09
141 0.09
142 0.09
143 0.09
144 0.1
145 0.1
146 0.1
147 0.1
148 0.09
149 0.11
150 0.11
151 0.11
152 0.1
153 0.09
154 0.09
155 0.1
156 0.12
157 0.13
158 0.17
159 0.19
160 0.19
161 0.19
162 0.19
163 0.17
164 0.14
165 0.12
166 0.07
167 0.08
168 0.08
169 0.08
170 0.1
171 0.11
172 0.12
173 0.12
174 0.14
175 0.13
176 0.13
177 0.14
178 0.13
179 0.13
180 0.13
181 0.12
182 0.11
183 0.08
184 0.09
185 0.08
186 0.09
187 0.07
188 0.09
189 0.1
190 0.1
191 0.09
192 0.09
193 0.09
194 0.11
195 0.14
196 0.13
197 0.16
198 0.16
199 0.17
200 0.19
201 0.2
202 0.23
203 0.3
204 0.37
205 0.39
206 0.42
207 0.42
208 0.42
209 0.41
210 0.38
211 0.29
212 0.24
213 0.19
214 0.16
215 0.15
216 0.14
217 0.15
218 0.14
219 0.14
220 0.13
221 0.12
222 0.12
223 0.13
224 0.14
225 0.13
226 0.11
227 0.12
228 0.14
229 0.15
230 0.15
231 0.14
232 0.15
233 0.14
234 0.14
235 0.13
236 0.1
237 0.09
238 0.08
239 0.07
240 0.07
241 0.07
242 0.07
243 0.07
244 0.07
245 0.06
246 0.06
247 0.05
248 0.06
249 0.06
250 0.05
251 0.05
252 0.05
253 0.06
254 0.06
255 0.06
256 0.06
257 0.06
258 0.06
259 0.06
260 0.06
261 0.05
262 0.06
263 0.06
264 0.06
265 0.07
266 0.07
267 0.1
268 0.11
269 0.11
270 0.15
271 0.16
272 0.18
273 0.2
274 0.22
275 0.19
276 0.18
277 0.2
278 0.18
279 0.18
280 0.16
281 0.13
282 0.12
283 0.12
284 0.12
285 0.09
286 0.07
287 0.07
288 0.07
289 0.07
290 0.08
291 0.09
292 0.11
293 0.12
294 0.12
295 0.12
296 0.13
297 0.13
298 0.14
299 0.14
300 0.12
301 0.13
302 0.14
303 0.13
304 0.12
305 0.11
306 0.1
307 0.09
308 0.09
309 0.07
310 0.07
311 0.07
312 0.07
313 0.07
314 0.08
315 0.08
316 0.1
317 0.13
318 0.13
319 0.14
320 0.17
321 0.17
322 0.16
323 0.17
324 0.15
325 0.13
326 0.14
327 0.13
328 0.11
329 0.14
330 0.14
331 0.13
332 0.14
333 0.14
334 0.13
335 0.13
336 0.12
337 0.09
338 0.09
339 0.09
340 0.08
341 0.09
342 0.09
343 0.12
344 0.16
345 0.17
346 0.16
347 0.17
348 0.17
349 0.18
350 0.22
351 0.23
352 0.19
353 0.2
354 0.21
355 0.2
356 0.21
357 0.2
358 0.17
359 0.16
360 0.17
361 0.16
362 0.14
363 0.14
364 0.14
365 0.13
366 0.12
367 0.11
368 0.09
369 0.11
370 0.15
371 0.17
372 0.16
373 0.17
374 0.17
375 0.17
376 0.17
377 0.17
378 0.19
379 0.19
380 0.2
381 0.2
382 0.2
383 0.21
384 0.29
385 0.33
386 0.3
387 0.35
388 0.42
389 0.48
390 0.55
391 0.63
392 0.66
393 0.7
394 0.76