Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NIL8

Protein Details
Accession J3NIL8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
103-122ARQGRLKKPLGIKPWRPRDDBasic
NLS Segment(s)
PositionSequence
106-115GRLKKPLGIK
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, cyto 7.5, mito 5, pero 3
Family & Domain DBs
Amino Acid Sequences MASNRQVPGENTAPAPTAARDDNWDEARYEASLKHLHELHVKLRKLRSTVPRMIEPAAETRSHETPEELFAFLQQSVSKGMGDVKEFKAAMNDETTVKIMERARQGRLKKPLGIKPWRPRDDPNWTKMDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.16
4 0.16
5 0.16
6 0.16
7 0.18
8 0.2
9 0.25
10 0.27
11 0.27
12 0.24
13 0.23
14 0.23
15 0.2
16 0.18
17 0.13
18 0.14
19 0.17
20 0.17
21 0.21
22 0.21
23 0.22
24 0.27
25 0.29
26 0.33
27 0.37
28 0.38
29 0.39
30 0.42
31 0.44
32 0.41
33 0.46
34 0.47
35 0.47
36 0.52
37 0.5
38 0.48
39 0.47
40 0.44
41 0.37
42 0.29
43 0.24
44 0.2
45 0.16
46 0.15
47 0.16
48 0.16
49 0.17
50 0.16
51 0.13
52 0.12
53 0.14
54 0.14
55 0.11
56 0.1
57 0.09
58 0.1
59 0.09
60 0.09
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.07
67 0.09
68 0.1
69 0.12
70 0.15
71 0.15
72 0.18
73 0.18
74 0.18
75 0.19
76 0.18
77 0.18
78 0.16
79 0.16
80 0.13
81 0.14
82 0.15
83 0.12
84 0.12
85 0.15
86 0.15
87 0.19
88 0.27
89 0.3
90 0.35
91 0.42
92 0.47
93 0.51
94 0.59
95 0.59
96 0.57
97 0.62
98 0.64
99 0.66
100 0.72
101 0.73
102 0.75
103 0.8
104 0.8
105 0.76
106 0.75
107 0.73
108 0.75
109 0.72
110 0.68
111 0.62