Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5UZD3

Protein Details
Accession A0A2N5UZD3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-26RPKGVRTPPQTPKKKACGGCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MEPLAARPKGVRTPPQTPKKKACGGCTPSQQGVQTPARPPPHAARRPHAYKWREDGRLGVRPRRTGVLAMHACPEGMQALHALRTGVYGRHACPARLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.77
4 0.77
5 0.79
6 0.79
7 0.8
8 0.75
9 0.72
10 0.72
11 0.69
12 0.68
13 0.66
14 0.62
15 0.55
16 0.52
17 0.45
18 0.36
19 0.36
20 0.32
21 0.29
22 0.26
23 0.31
24 0.32
25 0.32
26 0.34
27 0.36
28 0.42
29 0.46
30 0.47
31 0.47
32 0.52
33 0.57
34 0.6
35 0.6
36 0.52
37 0.49
38 0.52
39 0.54
40 0.48
41 0.43
42 0.41
43 0.38
44 0.43
45 0.43
46 0.42
47 0.38
48 0.38
49 0.39
50 0.37
51 0.33
52 0.28
53 0.25
54 0.29
55 0.28
56 0.27
57 0.27
58 0.24
59 0.23
60 0.2
61 0.19
62 0.1
63 0.08
64 0.07
65 0.07
66 0.08
67 0.09
68 0.1
69 0.09
70 0.08
71 0.11
72 0.12
73 0.11
74 0.16
75 0.18
76 0.19
77 0.27
78 0.3