Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8UZC9

Protein Details
Accession J8UZC9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22KKRISKLRKFRNKKTLSFFKFAHydrophilic
NLS Segment(s)
PositionSequence
4-13ISKLRKFRNK
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
Amino Acid Sequences KKRISKLRKFRNKKTLSFFKFAFRINQYFTNPNLALFGFNKIAETKGINECRAVNDLTAPSNTAPFKSQSATSTGTLRNRTVAITSLFITKDLILTQHFTCTTVSLLSCKPLGTVTIGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.82
4 0.78
5 0.69
6 0.64
7 0.6
8 0.53
9 0.5
10 0.44
11 0.4
12 0.38
13 0.42
14 0.39
15 0.39
16 0.38
17 0.38
18 0.33
19 0.29
20 0.27
21 0.21
22 0.19
23 0.17
24 0.18
25 0.12
26 0.12
27 0.13
28 0.12
29 0.13
30 0.12
31 0.12
32 0.12
33 0.18
34 0.21
35 0.21
36 0.21
37 0.21
38 0.22
39 0.23
40 0.2
41 0.12
42 0.11
43 0.11
44 0.11
45 0.11
46 0.1
47 0.08
48 0.1
49 0.1
50 0.1
51 0.1
52 0.11
53 0.12
54 0.13
55 0.14
56 0.12
57 0.16
58 0.18
59 0.18
60 0.2
61 0.23
62 0.26
63 0.28
64 0.27
65 0.25
66 0.22
67 0.22
68 0.19
69 0.18
70 0.15
71 0.14
72 0.14
73 0.15
74 0.15
75 0.15
76 0.14
77 0.12
78 0.11
79 0.1
80 0.1
81 0.09
82 0.13
83 0.13
84 0.16
85 0.16
86 0.16
87 0.16
88 0.16
89 0.16
90 0.14
91 0.15
92 0.14
93 0.15
94 0.17
95 0.18
96 0.16
97 0.16
98 0.15
99 0.15