Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5SZK9

Protein Details
Accession A0A2N5SZK9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-34PQTARPKGVRTPPRTPKKRRAGAARLPNQHydrophilic
NLS Segment(s)
PositionSequence
10-30RPKGVRTPPRTPKKRRAGAAR
Subcellular Location(s) mito 14, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MLSKIPQTARPKGVRTPPRTPKKRRAGAARLPNQACKPPHALPRMPHAYKWREDGRLGVRPRRTGVLAMHACLEGVQALHALRTGVHGWHACLARLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.68
3 0.71
4 0.73
5 0.78
6 0.84
7 0.85
8 0.86
9 0.87
10 0.87
11 0.84
12 0.84
13 0.82
14 0.82
15 0.83
16 0.8
17 0.77
18 0.7
19 0.66
20 0.58
21 0.55
22 0.46
23 0.39
24 0.37
25 0.34
26 0.4
27 0.41
28 0.42
29 0.38
30 0.45
31 0.5
32 0.45
33 0.43
34 0.42
35 0.41
36 0.39
37 0.43
38 0.38
39 0.32
40 0.31
41 0.33
42 0.32
43 0.36
44 0.38
45 0.38
46 0.38
47 0.38
48 0.39
49 0.37
50 0.33
51 0.27
52 0.25
53 0.29
54 0.27
55 0.25
56 0.25
57 0.22
58 0.21
59 0.17
60 0.16
61 0.06
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.06
69 0.06
70 0.09
71 0.1
72 0.1
73 0.15
74 0.16
75 0.16
76 0.22
77 0.24