Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6SS36

Protein Details
Accession A0A2J6SS36    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-39TPAQREAARQRREEKRKKKQDEQAKKDALKBasic
NLS Segment(s)
PositionSequence
17-56ARQRREEKRKKKQDEQAKKDALKREKKAWLRNYKARLEKK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MGAGSSTPMTPAQREAARQRREEKRKKKQDEQAKKDALKREKKAWLRNYKARLEKKWWHAGWWPIYEWWKEKSAWEEELYRRRKEGLLDSEGVPLRAHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.38
3 0.45
4 0.5
5 0.54
6 0.6
7 0.65
8 0.73
9 0.79
10 0.8
11 0.81
12 0.86
13 0.9
14 0.91
15 0.9
16 0.9
17 0.9
18 0.87
19 0.86
20 0.82
21 0.77
22 0.72
23 0.71
24 0.69
25 0.67
26 0.63
27 0.6
28 0.61
29 0.65
30 0.69
31 0.7
32 0.71
33 0.69
34 0.72
35 0.71
36 0.69
37 0.71
38 0.68
39 0.62
40 0.6
41 0.6
42 0.59
43 0.63
44 0.56
45 0.5
46 0.49
47 0.5
48 0.47
49 0.42
50 0.36
51 0.29
52 0.32
53 0.31
54 0.3
55 0.26
56 0.24
57 0.22
58 0.24
59 0.26
60 0.27
61 0.28
62 0.27
63 0.31
64 0.36
65 0.45
66 0.48
67 0.44
68 0.42
69 0.41
70 0.41
71 0.39
72 0.41
73 0.39
74 0.4
75 0.41
76 0.4
77 0.44
78 0.43
79 0.39