Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PB80

Protein Details
Accession J3PB80   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
110-134TSSPATPAPQKKRGRPKGWKPGMAYHydrophilic
202-225ALKGPPKPRGRPPKKPPPTPREIYBasic
NLS Segment(s)
PositionSequence
119-129QKKRGRPKGWK
167-220GRPPGRPPGRPPGPGRAASKPVGRPVGRPPGSSSGALKGPPKPRGRPPKKPPPT
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003677  F:DNA binding  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MDVFQLYRRPTGSSASTPRNGTPGGPEKYVSSGAPNGGGLEVRLGPLPSRQAHAASRPSGYGGKGLDEGYPANGVVVSDLNPHFKRKAECSEGPTAAIKTAVKNAVAAATSSPATPAPQKKRGRPKGWKPGMAYSETTNNPRSEAARLLYVQRRMRENPNYQLGHHGRPPGRPPGRPPGPGRAASKPVGRPVGRPPGSSSGALKGPPKPRGRPPKKPPPTPREIYLSLKPRFEPYRCEWSGCQAELHNMTTLRAHVRKVHGGSTGCKWVSCTQNSATGAPTTASFPSGDRLAHHMEKVHMIPLQWLRGDGFKAGPISSAKTTTTASYDENGEAPAIPSYLLDKDGKELTPWVWYQKLEDNATRLANKKRLQQTLFQMNEDAPSEGEEDENGAGEDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.52
4 0.51
5 0.51
6 0.49
7 0.44
8 0.36
9 0.37
10 0.38
11 0.38
12 0.37
13 0.36
14 0.34
15 0.36
16 0.38
17 0.29
18 0.23
19 0.22
20 0.21
21 0.22
22 0.2
23 0.17
24 0.15
25 0.15
26 0.11
27 0.11
28 0.1
29 0.1
30 0.11
31 0.11
32 0.11
33 0.14
34 0.2
35 0.19
36 0.22
37 0.24
38 0.26
39 0.3
40 0.36
41 0.39
42 0.36
43 0.36
44 0.33
45 0.34
46 0.32
47 0.29
48 0.25
49 0.19
50 0.18
51 0.18
52 0.19
53 0.16
54 0.15
55 0.15
56 0.13
57 0.13
58 0.1
59 0.09
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.11
66 0.12
67 0.19
68 0.21
69 0.24
70 0.25
71 0.29
72 0.34
73 0.36
74 0.44
75 0.45
76 0.48
77 0.51
78 0.56
79 0.52
80 0.49
81 0.44
82 0.36
83 0.28
84 0.25
85 0.2
86 0.14
87 0.18
88 0.19
89 0.17
90 0.16
91 0.16
92 0.16
93 0.15
94 0.14
95 0.1
96 0.09
97 0.09
98 0.09
99 0.09
100 0.08
101 0.09
102 0.16
103 0.25
104 0.31
105 0.41
106 0.48
107 0.57
108 0.68
109 0.77
110 0.81
111 0.82
112 0.85
113 0.87
114 0.88
115 0.85
116 0.77
117 0.74
118 0.67
119 0.59
120 0.49
121 0.39
122 0.37
123 0.33
124 0.33
125 0.29
126 0.26
127 0.24
128 0.24
129 0.23
130 0.19
131 0.2
132 0.18
133 0.17
134 0.18
135 0.22
136 0.25
137 0.31
138 0.32
139 0.33
140 0.37
141 0.38
142 0.45
143 0.49
144 0.5
145 0.49
146 0.54
147 0.52
148 0.47
149 0.53
150 0.48
151 0.42
152 0.39
153 0.39
154 0.33
155 0.35
156 0.38
157 0.39
158 0.41
159 0.39
160 0.42
161 0.46
162 0.49
163 0.52
164 0.51
165 0.49
166 0.49
167 0.52
168 0.5
169 0.44
170 0.42
171 0.39
172 0.4
173 0.33
174 0.32
175 0.34
176 0.31
177 0.29
178 0.32
179 0.4
180 0.36
181 0.35
182 0.35
183 0.34
184 0.35
185 0.34
186 0.28
187 0.2
188 0.2
189 0.21
190 0.2
191 0.21
192 0.25
193 0.32
194 0.37
195 0.39
196 0.47
197 0.57
198 0.64
199 0.69
200 0.73
201 0.76
202 0.81
203 0.86
204 0.87
205 0.84
206 0.83
207 0.75
208 0.68
209 0.63
210 0.58
211 0.52
212 0.49
213 0.49
214 0.44
215 0.42
216 0.39
217 0.38
218 0.39
219 0.36
220 0.36
221 0.33
222 0.41
223 0.4
224 0.43
225 0.38
226 0.4
227 0.42
228 0.35
229 0.31
230 0.21
231 0.23
232 0.22
233 0.23
234 0.18
235 0.15
236 0.15
237 0.14
238 0.15
239 0.18
240 0.18
241 0.18
242 0.21
243 0.25
244 0.3
245 0.31
246 0.32
247 0.32
248 0.32
249 0.33
250 0.31
251 0.34
252 0.28
253 0.26
254 0.26
255 0.27
256 0.32
257 0.31
258 0.31
259 0.26
260 0.33
261 0.34
262 0.33
263 0.29
264 0.22
265 0.21
266 0.17
267 0.16
268 0.11
269 0.1
270 0.1
271 0.09
272 0.09
273 0.11
274 0.13
275 0.12
276 0.12
277 0.16
278 0.21
279 0.22
280 0.23
281 0.23
282 0.23
283 0.26
284 0.25
285 0.23
286 0.19
287 0.17
288 0.22
289 0.23
290 0.25
291 0.21
292 0.21
293 0.2
294 0.21
295 0.22
296 0.17
297 0.15
298 0.14
299 0.15
300 0.15
301 0.16
302 0.15
303 0.18
304 0.19
305 0.2
306 0.18
307 0.19
308 0.2
309 0.19
310 0.2
311 0.18
312 0.18
313 0.18
314 0.19
315 0.18
316 0.18
317 0.17
318 0.15
319 0.13
320 0.12
321 0.1
322 0.09
323 0.08
324 0.07
325 0.09
326 0.1
327 0.13
328 0.13
329 0.13
330 0.17
331 0.2
332 0.2
333 0.19
334 0.2
335 0.18
336 0.22
337 0.23
338 0.25
339 0.25
340 0.25
341 0.28
342 0.33
343 0.39
344 0.38
345 0.4
346 0.39
347 0.4
348 0.43
349 0.43
350 0.42
351 0.44
352 0.48
353 0.49
354 0.55
355 0.6
356 0.66
357 0.65
358 0.67
359 0.69
360 0.7
361 0.68
362 0.6
363 0.52
364 0.43
365 0.42
366 0.36
367 0.27
368 0.17
369 0.15
370 0.15
371 0.14
372 0.14
373 0.11
374 0.11
375 0.1
376 0.11