Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TCE3

Protein Details
Accession A0A2J6TCE3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
278-307GYYYVKSHFRRMPKRKTKKGEAEAERKEVEBasic
NLS Segment(s)
PositionSequence
287-298RRMPKRKTKKGE
Subcellular Location(s) nucl 16, cyto_nucl 12.333, cyto 6.5, cyto_mito 6.166
Family & Domain DBs
Amino Acid Sequences MAPNAFSSYNASELNRTISGLNDTKLTLTFKLNLLRSSASSSPTHLATFDDLVDRLVDIGSQIWGLEEQNNKNKESGANTGDDNEEVRKALKSVMVLVGTLDTLGEEVMRLKFALEGVEKAAVSSGKNTLNTTTAASNQGGAPGGSQSIAKAATATPLQDDVATGASPNPAASATAAHEEQRLLKLMLPPEGAQETVGFGKSVPAPPGPRNLPPVGRTSSQNVPAAASTKLQIPAAKKQKLNHASDDQSAASASDSAKIKRELGAPKPAKVPNWAPEGYYYVKSHFRRMPKRKTKKGEAEAERKEVEQPASVEIVHLDGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.22
4 0.19
5 0.19
6 0.24
7 0.25
8 0.24
9 0.21
10 0.21
11 0.21
12 0.23
13 0.24
14 0.19
15 0.2
16 0.22
17 0.24
18 0.31
19 0.33
20 0.32
21 0.32
22 0.32
23 0.3
24 0.33
25 0.3
26 0.27
27 0.25
28 0.27
29 0.26
30 0.26
31 0.25
32 0.19
33 0.19
34 0.17
35 0.17
36 0.15
37 0.14
38 0.13
39 0.13
40 0.13
41 0.11
42 0.09
43 0.08
44 0.07
45 0.05
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.06
52 0.07
53 0.11
54 0.16
55 0.22
56 0.3
57 0.33
58 0.33
59 0.34
60 0.34
61 0.33
62 0.31
63 0.31
64 0.25
65 0.25
66 0.24
67 0.25
68 0.24
69 0.22
70 0.18
71 0.14
72 0.12
73 0.1
74 0.11
75 0.1
76 0.1
77 0.11
78 0.12
79 0.11
80 0.13
81 0.15
82 0.14
83 0.13
84 0.13
85 0.11
86 0.09
87 0.09
88 0.06
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.09
102 0.09
103 0.09
104 0.1
105 0.11
106 0.11
107 0.1
108 0.11
109 0.09
110 0.08
111 0.09
112 0.11
113 0.12
114 0.14
115 0.14
116 0.14
117 0.15
118 0.16
119 0.16
120 0.13
121 0.12
122 0.14
123 0.13
124 0.13
125 0.11
126 0.11
127 0.1
128 0.08
129 0.07
130 0.05
131 0.05
132 0.05
133 0.05
134 0.04
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.06
141 0.07
142 0.07
143 0.06
144 0.07
145 0.07
146 0.07
147 0.06
148 0.05
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.06
162 0.08
163 0.08
164 0.08
165 0.09
166 0.09
167 0.1
168 0.1
169 0.11
170 0.1
171 0.12
172 0.14
173 0.15
174 0.17
175 0.17
176 0.16
177 0.16
178 0.16
179 0.14
180 0.11
181 0.1
182 0.09
183 0.08
184 0.08
185 0.07
186 0.06
187 0.08
188 0.1
189 0.11
190 0.12
191 0.14
192 0.18
193 0.19
194 0.26
195 0.27
196 0.28
197 0.31
198 0.33
199 0.33
200 0.32
201 0.35
202 0.32
203 0.31
204 0.3
205 0.3
206 0.32
207 0.34
208 0.34
209 0.29
210 0.26
211 0.25
212 0.25
213 0.21
214 0.16
215 0.12
216 0.13
217 0.14
218 0.15
219 0.17
220 0.19
221 0.28
222 0.37
223 0.43
224 0.43
225 0.45
226 0.55
227 0.6
228 0.61
229 0.58
230 0.55
231 0.52
232 0.5
233 0.49
234 0.38
235 0.3
236 0.26
237 0.19
238 0.13
239 0.11
240 0.09
241 0.12
242 0.15
243 0.16
244 0.2
245 0.22
246 0.23
247 0.25
248 0.32
249 0.34
250 0.37
251 0.47
252 0.45
253 0.47
254 0.53
255 0.53
256 0.48
257 0.48
258 0.48
259 0.43
260 0.47
261 0.44
262 0.37
263 0.36
264 0.39
265 0.35
266 0.33
267 0.29
268 0.26
269 0.35
270 0.36
271 0.42
272 0.44
273 0.51
274 0.58
275 0.68
276 0.75
277 0.77
278 0.87
279 0.89
280 0.93
281 0.93
282 0.93
283 0.92
284 0.91
285 0.9
286 0.89
287 0.84
288 0.8
289 0.7
290 0.6
291 0.54
292 0.47
293 0.39
294 0.34
295 0.29
296 0.26
297 0.26
298 0.24
299 0.22
300 0.18