Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NYH0

Protein Details
Accession J3NYH0    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-62GSAGKTGAARPKRRKRAMPPSGYMHydrophilic
NLS Segment(s)
PositionSequence
41-55AGKTGAARPKRRKRA
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MSLPRPGRSRLSFVPKCWSLHDTATPPFWAAARSRTAAGSAGKTGAARPKRRKRAMPPSGYMLSRTWVYFFPVGLSSRQPKRLLGPHSCRPRTVSQPPRVPAQEATSASAPDSGRKQASTETAGAWLPEKKAVSTSTPSTVPEATPRRMTTQSKAAWLCRRVSQPSYHAPVYTILPGWRTGGVGVRRLAASANHSSEKARTLPPIAAEMRSLGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.56
4 0.53
5 0.47
6 0.4
7 0.39
8 0.43
9 0.37
10 0.36
11 0.37
12 0.33
13 0.31
14 0.27
15 0.23
16 0.19
17 0.17
18 0.19
19 0.21
20 0.22
21 0.22
22 0.22
23 0.22
24 0.23
25 0.23
26 0.21
27 0.17
28 0.16
29 0.16
30 0.16
31 0.17
32 0.22
33 0.29
34 0.36
35 0.46
36 0.57
37 0.67
38 0.75
39 0.82
40 0.84
41 0.87
42 0.88
43 0.85
44 0.78
45 0.74
46 0.69
47 0.6
48 0.51
49 0.4
50 0.32
51 0.25
52 0.21
53 0.16
54 0.13
55 0.16
56 0.14
57 0.13
58 0.13
59 0.14
60 0.15
61 0.15
62 0.18
63 0.22
64 0.26
65 0.31
66 0.31
67 0.29
68 0.34
69 0.4
70 0.42
71 0.45
72 0.48
73 0.51
74 0.6
75 0.6
76 0.55
77 0.53
78 0.51
79 0.49
80 0.52
81 0.53
82 0.52
83 0.58
84 0.58
85 0.58
86 0.55
87 0.48
88 0.39
89 0.33
90 0.29
91 0.23
92 0.23
93 0.19
94 0.18
95 0.16
96 0.18
97 0.15
98 0.12
99 0.13
100 0.13
101 0.14
102 0.14
103 0.15
104 0.13
105 0.16
106 0.16
107 0.16
108 0.14
109 0.14
110 0.14
111 0.13
112 0.13
113 0.12
114 0.1
115 0.11
116 0.11
117 0.1
118 0.12
119 0.14
120 0.16
121 0.18
122 0.2
123 0.2
124 0.2
125 0.21
126 0.21
127 0.2
128 0.17
129 0.22
130 0.25
131 0.25
132 0.29
133 0.29
134 0.32
135 0.37
136 0.4
137 0.36
138 0.4
139 0.39
140 0.42
141 0.43
142 0.45
143 0.46
144 0.46
145 0.44
146 0.41
147 0.44
148 0.43
149 0.44
150 0.43
151 0.41
152 0.45
153 0.49
154 0.44
155 0.39
156 0.35
157 0.33
158 0.3
159 0.26
160 0.2
161 0.15
162 0.15
163 0.16
164 0.16
165 0.14
166 0.13
167 0.12
168 0.17
169 0.19
170 0.23
171 0.23
172 0.23
173 0.23
174 0.23
175 0.23
176 0.18
177 0.21
178 0.22
179 0.26
180 0.26
181 0.27
182 0.28
183 0.28
184 0.31
185 0.29
186 0.26
187 0.26
188 0.27
189 0.29
190 0.29
191 0.34
192 0.32
193 0.29
194 0.26
195 0.24