Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TI47

Protein Details
Accession A0A2J6TI47    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-34GQNLSLFKARKKKKQKHNDSALSHPSHydrophilic
NLS Segment(s)
PositionSequence
16-24KARKKKKQK
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MLASRKASGQNLSLFKARKKKKQKHNDSALSHPSAPQSSTPHFSKSKSRSRSRCSCLHFTAMGRRIEGFCTLSHFQILTGWLNIVLALSLMAWKHACQLSPVSRIAYQSVGMYKIVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.49
4 0.53
5 0.57
6 0.65
7 0.72
8 0.78
9 0.85
10 0.9
11 0.91
12 0.93
13 0.92
14 0.86
15 0.83
16 0.77
17 0.7
18 0.58
19 0.48
20 0.4
21 0.31
22 0.27
23 0.22
24 0.21
25 0.2
26 0.25
27 0.26
28 0.29
29 0.3
30 0.31
31 0.38
32 0.41
33 0.48
34 0.52
35 0.6
36 0.63
37 0.7
38 0.77
39 0.73
40 0.72
41 0.68
42 0.65
43 0.58
44 0.52
45 0.45
46 0.37
47 0.39
48 0.37
49 0.32
50 0.26
51 0.24
52 0.22
53 0.21
54 0.21
55 0.15
56 0.1
57 0.15
58 0.16
59 0.15
60 0.15
61 0.14
62 0.13
63 0.13
64 0.14
65 0.1
66 0.09
67 0.09
68 0.08
69 0.08
70 0.08
71 0.07
72 0.05
73 0.03
74 0.03
75 0.03
76 0.04
77 0.04
78 0.06
79 0.06
80 0.07
81 0.12
82 0.13
83 0.14
84 0.15
85 0.22
86 0.27
87 0.31
88 0.33
89 0.31
90 0.31
91 0.32
92 0.32
93 0.26
94 0.21
95 0.2
96 0.2
97 0.19