Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6SWY6

Protein Details
Accession A0A2J6SWY6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSRIRNRKGENSRRRKRTLIKKAHEYGEBasic
NLS Segment(s)
PositionSequence
5-22RNRKGENSRRRKRTLIKK
Subcellular Location(s) nucl 14.5, mito_nucl 14.333, mito 12, cyto_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MSRIRNRKGENSRRRKRTLIKKAHEYGELSGADIAFFIYKSGHWFTYRSTNRQSFPPSWDEIVSFQMSYPLPVNLLPQDFNVKSKLVLPCAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.84
4 0.85
5 0.84
6 0.84
7 0.83
8 0.83
9 0.82
10 0.76
11 0.69
12 0.59
13 0.49
14 0.43
15 0.34
16 0.25
17 0.2
18 0.16
19 0.13
20 0.11
21 0.09
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.07
28 0.09
29 0.11
30 0.12
31 0.12
32 0.14
33 0.24
34 0.27
35 0.28
36 0.33
37 0.36
38 0.36
39 0.4
40 0.44
41 0.36
42 0.36
43 0.36
44 0.32
45 0.29
46 0.28
47 0.25
48 0.21
49 0.21
50 0.18
51 0.14
52 0.12
53 0.14
54 0.13
55 0.14
56 0.14
57 0.11
58 0.11
59 0.12
60 0.14
61 0.14
62 0.16
63 0.15
64 0.15
65 0.23
66 0.23
67 0.24
68 0.25
69 0.22
70 0.21
71 0.27
72 0.3