Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SI68

Protein Details
Accession A0A2J6SI68    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
43-63TVTDRRAKKKIQNRVAQRTYQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, pero 4
Family & Domain DBs
Amino Acid Sequences MDHNFSPLSVHGAANEPCYFFPSAGPSQRASGRAQPDADDWTTVTDRRAKKKIQNRVAQRTYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.18
4 0.17
5 0.19
6 0.19
7 0.14
8 0.14
9 0.16
10 0.19
11 0.22
12 0.24
13 0.22
14 0.24
15 0.26
16 0.27
17 0.24
18 0.25
19 0.24
20 0.24
21 0.24
22 0.22
23 0.21
24 0.23
25 0.21
26 0.16
27 0.13
28 0.14
29 0.15
30 0.14
31 0.16
32 0.2
33 0.26
34 0.34
35 0.4
36 0.44
37 0.53
38 0.62
39 0.71
40 0.74
41 0.78
42 0.8
43 0.84