Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PHD1

Protein Details
Accession J3PHD1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-90HGEHQEKKRQRNAKKKGGDABasic
NLS Segment(s)
PositionSequence
77-87KKRQRNAKKKG
Subcellular Location(s) cyto 16.5, cyto_nucl 13, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSGPPPDKFAKCMHCQAILYASTEDCIVCVANPWQICGNLVCGRLPPVKHNPVPKKIPGQSSINKNLWIGHGEHQEKKRQRNAKKKGGDAEEVKETADDPTDANEEVCVFGDMDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.43
4 0.41
5 0.34
6 0.3
7 0.23
8 0.19
9 0.16
10 0.15
11 0.13
12 0.09
13 0.08
14 0.06
15 0.05
16 0.07
17 0.08
18 0.11
19 0.12
20 0.13
21 0.14
22 0.14
23 0.15
24 0.13
25 0.17
26 0.16
27 0.17
28 0.16
29 0.15
30 0.18
31 0.2
32 0.21
33 0.21
34 0.26
35 0.32
36 0.36
37 0.45
38 0.49
39 0.53
40 0.57
41 0.55
42 0.54
43 0.51
44 0.51
45 0.45
46 0.44
47 0.42
48 0.45
49 0.48
50 0.42
51 0.38
52 0.35
53 0.32
54 0.27
55 0.23
56 0.19
57 0.17
58 0.23
59 0.26
60 0.31
61 0.34
62 0.42
63 0.46
64 0.52
65 0.56
66 0.58
67 0.65
68 0.7
69 0.77
70 0.79
71 0.8
72 0.79
73 0.78
74 0.73
75 0.7
76 0.63
77 0.57
78 0.5
79 0.43
80 0.37
81 0.29
82 0.24
83 0.18
84 0.16
85 0.12
86 0.08
87 0.11
88 0.13
89 0.13
90 0.13
91 0.12
92 0.12
93 0.12
94 0.12
95 0.11