Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TMG6

Protein Details
Accession A0A2J6TMG6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
95-120IFNSRFINKIKNKNIKKEFKKSRLVIHydrophilic
NLS Segment(s)
PositionSequence
107-115KNIKKEFKK
Subcellular Location(s) mito 15, nucl 5, cyto 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences LYKLIVIDGKFYILALLYSNTIFRLIFIKPFYIGDIKVITNNPESKPIPEFYNKAENNINNNLYKNSYQVKITSLLEKNIFKIISRSQILKEIYIFNSRFINKIKNKNIKKEFKKSRLVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.08
4 0.08
5 0.08
6 0.09
7 0.09
8 0.1
9 0.09
10 0.09
11 0.1
12 0.1
13 0.14
14 0.15
15 0.15
16 0.15
17 0.16
18 0.18
19 0.17
20 0.16
21 0.14
22 0.15
23 0.14
24 0.16
25 0.16
26 0.16
27 0.18
28 0.21
29 0.19
30 0.23
31 0.24
32 0.23
33 0.25
34 0.25
35 0.24
36 0.24
37 0.25
38 0.23
39 0.32
40 0.3
41 0.3
42 0.32
43 0.31
44 0.32
45 0.34
46 0.32
47 0.23
48 0.24
49 0.23
50 0.21
51 0.2
52 0.18
53 0.18
54 0.17
55 0.17
56 0.16
57 0.17
58 0.18
59 0.19
60 0.23
61 0.21
62 0.22
63 0.25
64 0.25
65 0.25
66 0.25
67 0.24
68 0.18
69 0.2
70 0.2
71 0.24
72 0.25
73 0.26
74 0.24
75 0.31
76 0.32
77 0.29
78 0.28
79 0.24
80 0.25
81 0.3
82 0.29
83 0.24
84 0.29
85 0.29
86 0.3
87 0.3
88 0.38
89 0.39
90 0.49
91 0.58
92 0.63
93 0.71
94 0.78
95 0.85
96 0.86
97 0.88
98 0.88
99 0.89
100 0.87