Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P3S0

Protein Details
Accession J3P3S0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKQKKQKKRRTTSTWTRHQMPHHydrophilic
NLS Segment(s)
PositionSequence
5-9KQKKR
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MKQKKQKKRRTTSTWTRHQMPHRHSRLLTFPSVQLLAAPVAVWCTLALDAQIGRLRAGGGRDKGPARGGLAPTPSLGAPPSLFDWDIQQQQRAPDFDQENSGGCVCRPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.87
3 0.83
4 0.79
5 0.78
6 0.77
7 0.74
8 0.74
9 0.69
10 0.68
11 0.62
12 0.59
13 0.57
14 0.52
15 0.47
16 0.38
17 0.32
18 0.28
19 0.28
20 0.23
21 0.16
22 0.13
23 0.1
24 0.08
25 0.07
26 0.05
27 0.05
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.06
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.11
45 0.13
46 0.13
47 0.14
48 0.17
49 0.18
50 0.19
51 0.19
52 0.18
53 0.16
54 0.17
55 0.17
56 0.17
57 0.18
58 0.17
59 0.16
60 0.16
61 0.13
62 0.11
63 0.1
64 0.09
65 0.07
66 0.09
67 0.1
68 0.11
69 0.12
70 0.11
71 0.15
72 0.18
73 0.26
74 0.26
75 0.27
76 0.27
77 0.31
78 0.36
79 0.34
80 0.32
81 0.33
82 0.34
83 0.32
84 0.34
85 0.31
86 0.28
87 0.28
88 0.27
89 0.2