Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TG23

Protein Details
Accession A0A2J6TG23    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
107-126IQGFLLKRKKEPRKALDEVEHydrophilic
NLS Segment(s)
PositionSequence
115-116KK
Subcellular Location(s) cyto 15, cyto_nucl 11.833, mito 7.5, mito_nucl 6.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences SHEGRVLVMTTNHDEKLDPVLIRPGHVDHKVKFENATQKQIEELFERMYTSSTKAVPNLNSNGTATGIPASSVAKPGEEKLGAEELSRIAGEFAKKVPGGVFSPAEIQGFLLKRKKEPRKALDEVEGWVEGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.25
4 0.25
5 0.2
6 0.18
7 0.25
8 0.24
9 0.25
10 0.25
11 0.23
12 0.24
13 0.31
14 0.34
15 0.29
16 0.37
17 0.39
18 0.38
19 0.37
20 0.37
21 0.41
22 0.4
23 0.45
24 0.37
25 0.35
26 0.36
27 0.35
28 0.31
29 0.23
30 0.2
31 0.15
32 0.14
33 0.14
34 0.13
35 0.13
36 0.12
37 0.12
38 0.13
39 0.13
40 0.14
41 0.15
42 0.18
43 0.19
44 0.22
45 0.22
46 0.21
47 0.2
48 0.19
49 0.18
50 0.15
51 0.13
52 0.1
53 0.07
54 0.06
55 0.05
56 0.06
57 0.06
58 0.06
59 0.08
60 0.08
61 0.08
62 0.09
63 0.09
64 0.12
65 0.11
66 0.11
67 0.11
68 0.13
69 0.12
70 0.12
71 0.12
72 0.09
73 0.09
74 0.09
75 0.07
76 0.06
77 0.07
78 0.08
79 0.09
80 0.09
81 0.12
82 0.12
83 0.13
84 0.13
85 0.14
86 0.15
87 0.17
88 0.17
89 0.15
90 0.17
91 0.17
92 0.17
93 0.14
94 0.13
95 0.14
96 0.16
97 0.21
98 0.26
99 0.27
100 0.35
101 0.46
102 0.56
103 0.61
104 0.7
105 0.73
106 0.76
107 0.81
108 0.78
109 0.75
110 0.66
111 0.57
112 0.49