Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PK30

Protein Details
Accession J3PK30   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-108GQPARPLWRHCAKRRRPETARRRQLLLHydrophilic
NLS Segment(s)
PositionSequence
94-99KRRRPE
Subcellular Location(s) nucl 10.5, cyto_nucl 9, mito 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGRKEGEDSVVVGAVGGKNSGTASGPGGLPEDGGKRGWDGGGQEEEHRRRARPGPSIDVSGRRADDAGECESGQAWHLAPLGQPARPLWRHCAKRRRPETARRRQLLLEPTPSRGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.06
5 0.06
6 0.07
7 0.07
8 0.07
9 0.07
10 0.08
11 0.1
12 0.1
13 0.1
14 0.11
15 0.1
16 0.1
17 0.1
18 0.11
19 0.1
20 0.11
21 0.11
22 0.1
23 0.11
24 0.1
25 0.1
26 0.09
27 0.11
28 0.13
29 0.13
30 0.15
31 0.22
32 0.24
33 0.28
34 0.29
35 0.27
36 0.29
37 0.35
38 0.38
39 0.39
40 0.41
41 0.41
42 0.41
43 0.44
44 0.4
45 0.38
46 0.34
47 0.28
48 0.24
49 0.17
50 0.16
51 0.13
52 0.13
53 0.12
54 0.12
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.1
61 0.08
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.13
68 0.14
69 0.14
70 0.15
71 0.15
72 0.22
73 0.26
74 0.28
75 0.3
76 0.39
77 0.48
78 0.57
79 0.67
80 0.69
81 0.77
82 0.83
83 0.85
84 0.85
85 0.87
86 0.88
87 0.89
88 0.89
89 0.82
90 0.77
91 0.7
92 0.68
93 0.66
94 0.61
95 0.6
96 0.51