Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P8C4

Protein Details
Accession J3P8C4   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
69-93DPEDETRQIKKRKKKMVEYKPLAITHydrophilic
NLS Segment(s)
PositionSequence
78-83KKRKKK
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MASKDTSSSIYAASSSELVGKAKAAAGGKPSLFSRVKAAFKSPAAERGQAVMDARPPRRDSDEWSYMTDPEDETRQIKKRKKKMVEYKPLAITQGSLASQGAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.11
5 0.11
6 0.11
7 0.11
8 0.1
9 0.1
10 0.13
11 0.12
12 0.12
13 0.14
14 0.17
15 0.17
16 0.18
17 0.17
18 0.21
19 0.21
20 0.2
21 0.24
22 0.27
23 0.3
24 0.29
25 0.32
26 0.3
27 0.3
28 0.32
29 0.27
30 0.28
31 0.27
32 0.26
33 0.24
34 0.21
35 0.2
36 0.18
37 0.17
38 0.1
39 0.13
40 0.17
41 0.18
42 0.2
43 0.21
44 0.22
45 0.28
46 0.28
47 0.31
48 0.34
49 0.39
50 0.37
51 0.39
52 0.38
53 0.32
54 0.32
55 0.26
56 0.19
57 0.14
58 0.14
59 0.13
60 0.15
61 0.21
62 0.28
63 0.37
64 0.45
65 0.54
66 0.62
67 0.71
68 0.78
69 0.83
70 0.86
71 0.88
72 0.91
73 0.88
74 0.85
75 0.79
76 0.7
77 0.6
78 0.49
79 0.39
80 0.29
81 0.25
82 0.18
83 0.14
84 0.13