Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P095

Protein Details
Accession J3P095    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-90APGRTVSRKKGKERREREGKKQKTRVPKQGCPGBasic
NLS Segment(s)
PositionSequence
62-84TVSRKKGKERREREGKKQKTRVP
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
Amino Acid Sequences MACGQYVRALIGRAGRGRFKGNAVDDDRGGKPCRRQAAWRGVAIAPFESHEAGPEGVAPGRTVSRKKGKERREREGKKQKTRVPKQGCPGGLPGSEAFPTLPSPLATPGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.31
4 0.34
5 0.35
6 0.33
7 0.35
8 0.34
9 0.38
10 0.38
11 0.38
12 0.34
13 0.36
14 0.35
15 0.32
16 0.32
17 0.28
18 0.3
19 0.33
20 0.39
21 0.37
22 0.42
23 0.47
24 0.54
25 0.55
26 0.5
27 0.47
28 0.41
29 0.39
30 0.34
31 0.26
32 0.15
33 0.11
34 0.11
35 0.09
36 0.08
37 0.07
38 0.08
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.07
48 0.1
49 0.12
50 0.18
51 0.28
52 0.35
53 0.45
54 0.54
55 0.63
56 0.71
57 0.77
58 0.81
59 0.83
60 0.83
61 0.84
62 0.86
63 0.86
64 0.86
65 0.87
66 0.84
67 0.84
68 0.86
69 0.86
70 0.84
71 0.8
72 0.78
73 0.77
74 0.7
75 0.61
76 0.55
77 0.48
78 0.39
79 0.34
80 0.26
81 0.21
82 0.19
83 0.18
84 0.14
85 0.12
86 0.13
87 0.12
88 0.13
89 0.11
90 0.13