Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6T1E6

Protein Details
Accession A0A2J6T1E6    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
195-216EKKVVAKEGKKRKVRVGRGLGVBasic
NLS Segment(s)
PositionSequence
195-212EKKVVAKEGKKRKVRVGR
Subcellular Location(s) nucl 14.5, cyto_nucl 13.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR045047  Ard1-like  
IPR000182  GNAT_dom  
Gene Ontology GO:0031415  C:NatA complex  
GO:0004596  F:peptide alpha-N-acetyltransferase activity  
GO:0006474  P:N-terminal protein amino acid acetylation  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MDIRLLHPSDIPHVQHANITNLPENYFMKYYLYHALSWPQLSFVAVDVSRPKKTPYDYPRIVGYVLAKMEEDPPDGVQHGHITSLSVMRTHRRLGIAEKLMRQSQRAMVETFGAQYVSLHVRVSNNAALRLYRDTLGFKNEKVEAKYYADGEDAYSMKLDLGFVREQVMDELDDGEVDEGEPVGELGKLEEREGEKKVVAKEGKKRKVRVGRGLGVGDLVEKNESQKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.33
4 0.33
5 0.29
6 0.3
7 0.29
8 0.28
9 0.29
10 0.29
11 0.27
12 0.25
13 0.24
14 0.22
15 0.19
16 0.19
17 0.21
18 0.24
19 0.25
20 0.22
21 0.22
22 0.25
23 0.26
24 0.27
25 0.24
26 0.18
27 0.16
28 0.16
29 0.15
30 0.11
31 0.13
32 0.11
33 0.13
34 0.19
35 0.23
36 0.25
37 0.25
38 0.27
39 0.29
40 0.33
41 0.41
42 0.43
43 0.49
44 0.5
45 0.51
46 0.51
47 0.47
48 0.43
49 0.34
50 0.27
51 0.2
52 0.17
53 0.15
54 0.13
55 0.12
56 0.14
57 0.13
58 0.13
59 0.11
60 0.11
61 0.11
62 0.12
63 0.11
64 0.1
65 0.1
66 0.09
67 0.09
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09
74 0.1
75 0.13
76 0.16
77 0.16
78 0.18
79 0.18
80 0.19
81 0.21
82 0.27
83 0.3
84 0.3
85 0.31
86 0.31
87 0.33
88 0.32
89 0.29
90 0.24
91 0.22
92 0.22
93 0.22
94 0.2
95 0.17
96 0.18
97 0.17
98 0.15
99 0.11
100 0.08
101 0.06
102 0.05
103 0.06
104 0.07
105 0.07
106 0.07
107 0.07
108 0.08
109 0.09
110 0.11
111 0.13
112 0.12
113 0.13
114 0.13
115 0.12
116 0.14
117 0.15
118 0.13
119 0.11
120 0.11
121 0.13
122 0.14
123 0.2
124 0.19
125 0.17
126 0.19
127 0.22
128 0.25
129 0.24
130 0.25
131 0.22
132 0.24
133 0.26
134 0.23
135 0.2
136 0.18
137 0.16
138 0.14
139 0.13
140 0.1
141 0.09
142 0.08
143 0.08
144 0.07
145 0.07
146 0.07
147 0.05
148 0.09
149 0.09
150 0.09
151 0.11
152 0.11
153 0.11
154 0.11
155 0.12
156 0.09
157 0.08
158 0.09
159 0.07
160 0.07
161 0.07
162 0.06
163 0.05
164 0.05
165 0.04
166 0.04
167 0.04
168 0.04
169 0.03
170 0.04
171 0.04
172 0.04
173 0.05
174 0.1
175 0.11
176 0.11
177 0.15
178 0.18
179 0.22
180 0.24
181 0.25
182 0.23
183 0.27
184 0.29
185 0.34
186 0.37
187 0.41
188 0.49
189 0.58
190 0.66
191 0.7
192 0.73
193 0.75
194 0.79
195 0.81
196 0.82
197 0.8
198 0.77
199 0.74
200 0.69
201 0.59
202 0.48
203 0.39
204 0.3
205 0.21
206 0.16
207 0.12
208 0.11