Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NV44

Protein Details
Accession J3NV44    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MVIKCTKRKKKGLRFRTGKKAFYIHydrophilic
79-100HGTRKIYKINRACPKRHEKKEGBasic
NLS Segment(s)
PositionSequence
7-20KRKKKGLRFRTGKK
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MVIKCTKRKKKGLRFRTGKKAFYIPHCRALGRFNEIPLITSYLRNTPVRRIRFKINRIGKRQYIKNTGETACLNCTKAHGTRKIYKINRACPKRHEKKEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.88
5 0.8
6 0.73
7 0.7
8 0.63
9 0.62
10 0.63
11 0.56
12 0.56
13 0.54
14 0.51
15 0.44
16 0.44
17 0.38
18 0.35
19 0.32
20 0.24
21 0.26
22 0.26
23 0.26
24 0.22
25 0.22
26 0.16
27 0.16
28 0.16
29 0.15
30 0.19
31 0.21
32 0.21
33 0.26
34 0.33
35 0.38
36 0.42
37 0.43
38 0.49
39 0.56
40 0.59
41 0.61
42 0.63
43 0.65
44 0.66
45 0.7
46 0.66
47 0.65
48 0.66
49 0.63
50 0.62
51 0.56
52 0.54
53 0.52
54 0.46
55 0.42
56 0.37
57 0.32
58 0.27
59 0.26
60 0.22
61 0.18
62 0.19
63 0.2
64 0.25
65 0.31
66 0.36
67 0.41
68 0.49
69 0.56
70 0.65
71 0.66
72 0.7
73 0.71
74 0.74
75 0.77
76 0.76
77 0.75
78 0.75
79 0.81
80 0.82