Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NR69

Protein Details
Accession J3NR69    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-77LTRFRECWKRHNNDKRTQTKDAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039870  Coa4-like  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSKNESDAENKAVEDDDEPDEWDKRIFSTGCADENWKLTECHSEKKDWRKCTDELTRFRECWKRHNNDKRTQTKDAERE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.13
5 0.15
6 0.16
7 0.16
8 0.16
9 0.16
10 0.13
11 0.11
12 0.15
13 0.14
14 0.13
15 0.18
16 0.19
17 0.2
18 0.2
19 0.22
20 0.19
21 0.21
22 0.21
23 0.16
24 0.14
25 0.14
26 0.21
27 0.21
28 0.26
29 0.26
30 0.3
31 0.36
32 0.46
33 0.54
34 0.51
35 0.55
36 0.53
37 0.53
38 0.56
39 0.6
40 0.58
41 0.58
42 0.59
43 0.58
44 0.54
45 0.58
46 0.58
47 0.5
48 0.52
49 0.55
50 0.58
51 0.64
52 0.74
53 0.78
54 0.8
55 0.88
56 0.88
57 0.85
58 0.82
59 0.79