Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SS51

Protein Details
Accession A0A2J6SS51    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-51SFKAIRRKLKEYGKKRRKDTGLBasic
NLS Segment(s)
PositionSequence
33-47AIRRKLKEYGKKRRK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences FCDLPGIREKTFTVRTIKYAFQNAGIWPVSFKAIRRKLKEYGKKRRKDTGLENLEFGSDLDTKAEAENPPIPIPPPVHELEATYQLPTLPKPPSSYNEYVLRLDNLNDKILDALSSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.4
4 0.43
5 0.4
6 0.41
7 0.38
8 0.34
9 0.34
10 0.29
11 0.3
12 0.26
13 0.21
14 0.16
15 0.16
16 0.16
17 0.15
18 0.18
19 0.24
20 0.32
21 0.41
22 0.46
23 0.51
24 0.57
25 0.66
26 0.74
27 0.74
28 0.76
29 0.78
30 0.8
31 0.8
32 0.81
33 0.75
34 0.71
35 0.69
36 0.68
37 0.66
38 0.58
39 0.54
40 0.44
41 0.39
42 0.33
43 0.24
44 0.15
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.09
52 0.07
53 0.09
54 0.11
55 0.13
56 0.13
57 0.13
58 0.14
59 0.14
60 0.16
61 0.15
62 0.17
63 0.17
64 0.18
65 0.18
66 0.19
67 0.18
68 0.22
69 0.21
70 0.17
71 0.15
72 0.15
73 0.15
74 0.15
75 0.17
76 0.15
77 0.16
78 0.2
79 0.24
80 0.28
81 0.35
82 0.38
83 0.39
84 0.42
85 0.44
86 0.41
87 0.39
88 0.37
89 0.3
90 0.28
91 0.3
92 0.25
93 0.24
94 0.23
95 0.21
96 0.2
97 0.19
98 0.17