Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TWR7

Protein Details
Accession A0A2J6TWR7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAVKPPKRRSERLSRRKSTLHydrophilic
NLS Segment(s)
PositionSequence
5-17PPKRRSERLSRRK
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MAVKPPKRRSERLSRRKSTLINKAYELAELCNIDVALIIRNRQTGRYFTYNSVDLESWPPSKEQIASY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.77
4 0.77
5 0.74
6 0.73
7 0.68
8 0.6
9 0.54
10 0.51
11 0.45
12 0.38
13 0.3
14 0.2
15 0.15
16 0.13
17 0.11
18 0.09
19 0.08
20 0.07
21 0.06
22 0.06
23 0.07
24 0.07
25 0.08
26 0.09
27 0.12
28 0.12
29 0.15
30 0.17
31 0.17
32 0.23
33 0.28
34 0.31
35 0.31
36 0.34
37 0.34
38 0.32
39 0.32
40 0.26
41 0.22
42 0.22
43 0.23
44 0.21
45 0.2
46 0.2
47 0.19
48 0.21