Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8UJL5

Protein Details
Accession J8UJL5   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
106-125TLAGILKSCKRKRARWTRNIHydrophilic
NLS Segment(s)
PositionSequence
117-117K
Subcellular Location(s) mito 18, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences VNSIILICLTTKIAVTKYRTLRIIIFKKGQINKVPIIVLLEIDNFPQRERVANTHIKQKKSNVRFKSKSIKIESVAAAFVARFTLFFSKGFFAAAVKARRGVTGKTLAGILKSCKRKRARWTRNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.32
4 0.38
5 0.43
6 0.44
7 0.44
8 0.46
9 0.5
10 0.51
11 0.49
12 0.48
13 0.46
14 0.53
15 0.55
16 0.56
17 0.52
18 0.5
19 0.45
20 0.42
21 0.38
22 0.3
23 0.27
24 0.21
25 0.15
26 0.11
27 0.11
28 0.08
29 0.09
30 0.11
31 0.1
32 0.1
33 0.11
34 0.11
35 0.13
36 0.16
37 0.19
38 0.23
39 0.31
40 0.33
41 0.41
42 0.45
43 0.45
44 0.45
45 0.5
46 0.53
47 0.54
48 0.61
49 0.59
50 0.64
51 0.64
52 0.67
53 0.7
54 0.65
55 0.64
56 0.6
57 0.56
58 0.47
59 0.47
60 0.42
61 0.32
62 0.26
63 0.19
64 0.14
65 0.1
66 0.08
67 0.06
68 0.05
69 0.04
70 0.06
71 0.08
72 0.09
73 0.1
74 0.12
75 0.13
76 0.13
77 0.13
78 0.12
79 0.1
80 0.12
81 0.19
82 0.2
83 0.2
84 0.23
85 0.23
86 0.26
87 0.28
88 0.26
89 0.26
90 0.29
91 0.29
92 0.26
93 0.27
94 0.25
95 0.24
96 0.25
97 0.25
98 0.27
99 0.37
100 0.4
101 0.48
102 0.56
103 0.63
104 0.72
105 0.78