Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TP03

Protein Details
Accession A0A2J6TP03    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KRRSKRLSRRKSTLINKAYNHydrophilic
NLS Segment(s)
PositionSequence
3-10RSKRLSRR
Subcellular Location(s) mito 20, nucl 6.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences KRRSKRLSRRKSTLINKAYNLVEFCNINIALIIRNRRTSYYFMYNSINLKSWPPSKEQIVNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.78
3 0.69
4 0.64
5 0.56
6 0.47
7 0.39
8 0.29
9 0.22
10 0.17
11 0.15
12 0.14
13 0.13
14 0.1
15 0.1
16 0.09
17 0.09
18 0.12
19 0.15
20 0.14
21 0.17
22 0.18
23 0.2
24 0.22
25 0.24
26 0.27
27 0.32
28 0.32
29 0.32
30 0.34
31 0.35
32 0.34
33 0.33
34 0.28
35 0.21
36 0.22
37 0.25
38 0.28
39 0.28
40 0.31
41 0.35
42 0.4