Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T322

Protein Details
Accession A0A2J6T322    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-75NTLNMKKKLKRASRPKSRSGCRTCKIRRVKCDESRPQCERHydrophilic
NLS Segment(s)
PositionSequence
41-53KKKLKRASRPKSR
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences CNNLQLSLSEKDTHKPQLASGGGSQSSLPPDTIDANTLNMKKKLKRASRPKSRSGCRTCKIRRVKCDESRPQCERCIKFGTTCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.32
4 0.35
5 0.35
6 0.33
7 0.29
8 0.26
9 0.21
10 0.21
11 0.21
12 0.13
13 0.14
14 0.13
15 0.11
16 0.08
17 0.09
18 0.11
19 0.11
20 0.12
21 0.1
22 0.11
23 0.15
24 0.17
25 0.19
26 0.21
27 0.24
28 0.26
29 0.32
30 0.4
31 0.46
32 0.54
33 0.62
34 0.69
35 0.77
36 0.8
37 0.83
38 0.83
39 0.81
40 0.81
41 0.79
42 0.78
43 0.73
44 0.77
45 0.74
46 0.74
47 0.78
48 0.76
49 0.77
50 0.76
51 0.81
52 0.8
53 0.84
54 0.85
55 0.83
56 0.84
57 0.8
58 0.74
59 0.72
60 0.71
61 0.64
62 0.59
63 0.56
64 0.5