Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TGH5

Protein Details
Accession A0A2J6TGH5    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTVRVPYRCGKPRQARPVPRGVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MTVRVPYRCGKPRQARPVPRGVARQFLHQGTATGTLIRLLGPREALFLEVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.8
4 0.83
5 0.76
6 0.7
7 0.67
8 0.58
9 0.56
10 0.47
11 0.46
12 0.39
13 0.35
14 0.32
15 0.24
16 0.23
17 0.16
18 0.18
19 0.14
20 0.11
21 0.11
22 0.09
23 0.09
24 0.09
25 0.1
26 0.08
27 0.1
28 0.12
29 0.12
30 0.13
31 0.14