Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P0L0

Protein Details
Accession J3P0L0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-105RTRKVPPRTNAPRRFMRNRTHydrophilic
NLS Segment(s)
PositionSequence
26-29RKRK
Subcellular Location(s) cysk 11, nucl 7, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MAGVGARYALACDDCPCIHGIDEPRRKRKGHGWMERGTFAWMTAGDEGASGRVAYIEPQSRPTLSSHLPLTLAADLDPAGGLGASRTRKVPPRTNAPRRFMRNRTVEAGLEQVMITGLQDIERYEGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.15
5 0.15
6 0.19
7 0.25
8 0.32
9 0.42
10 0.5
11 0.58
12 0.62
13 0.63
14 0.64
15 0.65
16 0.65
17 0.66
18 0.67
19 0.66
20 0.67
21 0.69
22 0.64
23 0.56
24 0.46
25 0.35
26 0.25
27 0.18
28 0.12
29 0.1
30 0.09
31 0.08
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.08
43 0.11
44 0.11
45 0.14
46 0.15
47 0.15
48 0.17
49 0.17
50 0.17
51 0.15
52 0.17
53 0.15
54 0.15
55 0.15
56 0.14
57 0.14
58 0.11
59 0.09
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.07
71 0.09
72 0.1
73 0.11
74 0.15
75 0.24
76 0.32
77 0.41
78 0.43
79 0.53
80 0.64
81 0.73
82 0.79
83 0.77
84 0.79
85 0.79
86 0.81
87 0.76
88 0.74
89 0.71
90 0.66
91 0.64
92 0.58
93 0.5
94 0.42
95 0.39
96 0.3
97 0.23
98 0.18
99 0.13
100 0.1
101 0.09
102 0.08
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07