Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SZX3

Protein Details
Accession A0A2J6SZX3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
156-180STEISEPKLPKRRKPWEKDVPEDVIHydrophilic
NLS Segment(s)
PositionSequence
166-168KRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MSTETSTSDNTEIYRQLEVYPWDTDKEFQIGLTAILGPNPSPSQIHDLTLRAQCYYLSRKKSTPIDFEGYKSYLLSKSSTTPNPPVDSTSTQPELSHQPTTSPPQTPEMALQSTPHHEPEVEQKTAPYPPTFAQIVALITSNQPIPGIKEIPNILSTEISEPKLPKRRKPWEKDVPEDVIQGRAGGTFGDHRDEYIKQELPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.21
5 0.23
6 0.23
7 0.24
8 0.23
9 0.24
10 0.24
11 0.25
12 0.23
13 0.22
14 0.19
15 0.15
16 0.16
17 0.14
18 0.13
19 0.12
20 0.11
21 0.08
22 0.09
23 0.09
24 0.07
25 0.1
26 0.1
27 0.1
28 0.1
29 0.13
30 0.18
31 0.19
32 0.21
33 0.21
34 0.22
35 0.25
36 0.28
37 0.27
38 0.21
39 0.2
40 0.18
41 0.21
42 0.28
43 0.31
44 0.34
45 0.37
46 0.39
47 0.45
48 0.53
49 0.54
50 0.51
51 0.49
52 0.48
53 0.45
54 0.45
55 0.42
56 0.34
57 0.29
58 0.23
59 0.19
60 0.15
61 0.15
62 0.15
63 0.12
64 0.15
65 0.2
66 0.22
67 0.24
68 0.27
69 0.29
70 0.3
71 0.29
72 0.28
73 0.27
74 0.27
75 0.25
76 0.25
77 0.24
78 0.21
79 0.21
80 0.21
81 0.22
82 0.22
83 0.22
84 0.17
85 0.17
86 0.19
87 0.24
88 0.24
89 0.21
90 0.2
91 0.21
92 0.21
93 0.2
94 0.2
95 0.17
96 0.16
97 0.14
98 0.14
99 0.13
100 0.15
101 0.15
102 0.15
103 0.12
104 0.11
105 0.12
106 0.21
107 0.25
108 0.23
109 0.22
110 0.22
111 0.23
112 0.26
113 0.26
114 0.17
115 0.14
116 0.14
117 0.18
118 0.18
119 0.16
120 0.14
121 0.14
122 0.13
123 0.12
124 0.12
125 0.08
126 0.08
127 0.09
128 0.08
129 0.07
130 0.07
131 0.07
132 0.09
133 0.12
134 0.15
135 0.15
136 0.19
137 0.2
138 0.21
139 0.21
140 0.19
141 0.17
142 0.14
143 0.14
144 0.14
145 0.16
146 0.16
147 0.18
148 0.2
149 0.28
150 0.37
151 0.42
152 0.47
153 0.55
154 0.65
155 0.73
156 0.81
157 0.83
158 0.84
159 0.87
160 0.86
161 0.81
162 0.75
163 0.66
164 0.6
165 0.5
166 0.41
167 0.32
168 0.25
169 0.19
170 0.13
171 0.12
172 0.08
173 0.09
174 0.11
175 0.13
176 0.18
177 0.17
178 0.18
179 0.22
180 0.23
181 0.26
182 0.29
183 0.32