Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NQX7

Protein Details
Accession J3NQX7   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-97TLSKMERRPEAKPKKVRRGKVDVTLEEHydrophilic
NLS Segment(s)
PositionSequence
76-90ERRPEAKPKKVRRGK
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MSCVELERRNAGRFVGRTSLRHEKTTRQKNGGAAEGLSYQCYRHSSLASWGRDGASAGKLQRPLLDSNYKTLSKMERRPEAKPKKVRRGKVDVTLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.34
4 0.34
5 0.41
6 0.49
7 0.45
8 0.49
9 0.47
10 0.49
11 0.57
12 0.66
13 0.66
14 0.6
15 0.6
16 0.58
17 0.59
18 0.52
19 0.42
20 0.31
21 0.25
22 0.22
23 0.19
24 0.15
25 0.12
26 0.09
27 0.1
28 0.11
29 0.12
30 0.12
31 0.13
32 0.13
33 0.2
34 0.28
35 0.27
36 0.26
37 0.24
38 0.23
39 0.22
40 0.22
41 0.15
42 0.09
43 0.1
44 0.11
45 0.13
46 0.14
47 0.14
48 0.16
49 0.17
50 0.18
51 0.21
52 0.28
53 0.26
54 0.29
55 0.34
56 0.33
57 0.31
58 0.31
59 0.34
60 0.35
61 0.42
62 0.47
63 0.51
64 0.55
65 0.61
66 0.7
67 0.72
68 0.74
69 0.77
70 0.79
71 0.81
72 0.87
73 0.89
74 0.87
75 0.86
76 0.83
77 0.83