Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PJR4

Protein Details
Accession J3PJR4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-136RLPGRVRRRRGLSVKGGRLRBasic
NLS Segment(s)
PositionSequence
119-135PGRVRRRRGLSVKGGRL
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSAGSIPQTCSHPRCREITPGRGIFCRRCRSITVGGEWAIRDIVWGLREAVRSGDVDTHITEMAESVILQLSREVAAMCSDLSQTPTQDLLSPDESQSARFLAQAVAHGPIRLITSRLPGRVRRRRGLSVKGGRLRGQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.57
4 0.58
5 0.61
6 0.6
7 0.58
8 0.56
9 0.57
10 0.58
11 0.56
12 0.57
13 0.56
14 0.5
15 0.49
16 0.49
17 0.5
18 0.54
19 0.5
20 0.45
21 0.4
22 0.38
23 0.36
24 0.33
25 0.27
26 0.18
27 0.14
28 0.1
29 0.07
30 0.08
31 0.07
32 0.08
33 0.09
34 0.11
35 0.11
36 0.12
37 0.12
38 0.11
39 0.11
40 0.11
41 0.11
42 0.1
43 0.11
44 0.1
45 0.11
46 0.1
47 0.09
48 0.08
49 0.06
50 0.06
51 0.05
52 0.04
53 0.03
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.08
70 0.08
71 0.08
72 0.09
73 0.1
74 0.1
75 0.11
76 0.13
77 0.14
78 0.16
79 0.16
80 0.15
81 0.18
82 0.18
83 0.17
84 0.16
85 0.14
86 0.12
87 0.11
88 0.12
89 0.09
90 0.1
91 0.1
92 0.1
93 0.12
94 0.12
95 0.12
96 0.11
97 0.11
98 0.13
99 0.12
100 0.12
101 0.11
102 0.19
103 0.23
104 0.28
105 0.33
106 0.39
107 0.5
108 0.58
109 0.66
110 0.67
111 0.71
112 0.76
113 0.79
114 0.79
115 0.79
116 0.79
117 0.8
118 0.78
119 0.76