Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6SWC7

Protein Details
Accession A0A2J6SWC7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-37VTPRSPSRPSRPTKNAKRAARRHSVPHydrophilic
NLS Segment(s)
PositionSequence
18-34SRPSRPTKNAKRAARRH
Subcellular Location(s) mito 20, extr 5
Family & Domain DBs
Amino Acid Sequences MAPWALAWLPAVTPRSPSRPSRPTKNAKRAARRHSVPPLAAPLPERNPEVLTAALSCWNWLIAATPPTATRPDLTRLFSQMAQQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.33
4 0.39
5 0.44
6 0.51
7 0.58
8 0.63
9 0.7
10 0.74
11 0.8
12 0.84
13 0.84
14 0.84
15 0.87
16 0.86
17 0.84
18 0.82
19 0.74
20 0.7
21 0.69
22 0.63
23 0.53
24 0.45
25 0.42
26 0.33
27 0.3
28 0.25
29 0.19
30 0.19
31 0.2
32 0.19
33 0.16
34 0.16
35 0.16
36 0.15
37 0.13
38 0.1
39 0.09
40 0.08
41 0.1
42 0.09
43 0.09
44 0.07
45 0.07
46 0.07
47 0.06
48 0.08
49 0.08
50 0.1
51 0.11
52 0.12
53 0.12
54 0.14
55 0.17
56 0.16
57 0.15
58 0.17
59 0.23
60 0.27
61 0.3
62 0.31
63 0.33
64 0.35
65 0.35