Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6TRG0

Protein Details
Accession A0A2J6TRG0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
35-54QNPCWRCRILKKKCDAKSTCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences MRGVTYCANSEHNSKPEERQDQLTCSEEKRAKAGQNPCWRCRILKKKCDAKSTCEECDMTEGRTWELGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.42
4 0.46
5 0.43
6 0.44
7 0.42
8 0.42
9 0.43
10 0.4
11 0.32
12 0.28
13 0.32
14 0.29
15 0.27
16 0.28
17 0.28
18 0.28
19 0.34
20 0.4
21 0.41
22 0.49
23 0.54
24 0.52
25 0.52
26 0.5
27 0.46
28 0.5
29 0.52
30 0.52
31 0.55
32 0.63
33 0.69
34 0.75
35 0.82
36 0.74
37 0.71
38 0.71
39 0.69
40 0.62
41 0.55
42 0.48
43 0.39
44 0.42
45 0.36
46 0.28
47 0.25
48 0.23
49 0.21