Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6TLV1

Protein Details
Accession A0A2J6TLV1    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-74RLVKESPSKAKQKKNLTARTQFHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences MGSLSLFLLSLDNEQEILPIMTRFPKFPPEIRNMVWTFAAMEPEVFTVKIRRLVKESPSKAKQKKNLTARTQFHFKYEATSGPINLHGYNTPHSSLRSATNESRAAYKKFRSHEIQLLGYGPDNKVFFNPSVDVLHFDDFSSLFSHHLRQRLRRPLPFLSGLDKAEKIAFDPTPDSDRIEDLSEEVVEDFKMRTTRIEMGWIENGTEYKKDFGWRRAKLLEENRLMGEMRPRAIRNSGALGRVNGGYISVEAKILRLPLTAKDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.1
5 0.1
6 0.09
7 0.11
8 0.17
9 0.18
10 0.2
11 0.21
12 0.28
13 0.32
14 0.38
15 0.44
16 0.44
17 0.49
18 0.49
19 0.54
20 0.48
21 0.45
22 0.39
23 0.31
24 0.27
25 0.22
26 0.21
27 0.13
28 0.12
29 0.11
30 0.12
31 0.12
32 0.1
33 0.1
34 0.12
35 0.15
36 0.23
37 0.25
38 0.27
39 0.31
40 0.36
41 0.44
42 0.52
43 0.56
44 0.58
45 0.63
46 0.7
47 0.73
48 0.77
49 0.77
50 0.77
51 0.8
52 0.8
53 0.82
54 0.81
55 0.82
56 0.78
57 0.75
58 0.72
59 0.63
60 0.55
61 0.49
62 0.4
63 0.34
64 0.31
65 0.27
66 0.23
67 0.23
68 0.21
69 0.19
70 0.21
71 0.18
72 0.16
73 0.15
74 0.13
75 0.14
76 0.16
77 0.17
78 0.16
79 0.16
80 0.17
81 0.17
82 0.17
83 0.2
84 0.21
85 0.24
86 0.24
87 0.28
88 0.29
89 0.28
90 0.32
91 0.31
92 0.31
93 0.31
94 0.34
95 0.35
96 0.36
97 0.41
98 0.4
99 0.41
100 0.43
101 0.42
102 0.38
103 0.32
104 0.3
105 0.25
106 0.21
107 0.18
108 0.12
109 0.1
110 0.1
111 0.1
112 0.09
113 0.11
114 0.1
115 0.11
116 0.11
117 0.11
118 0.12
119 0.12
120 0.13
121 0.13
122 0.13
123 0.12
124 0.11
125 0.1
126 0.09
127 0.09
128 0.08
129 0.07
130 0.08
131 0.08
132 0.13
133 0.15
134 0.22
135 0.25
136 0.31
137 0.4
138 0.49
139 0.55
140 0.55
141 0.58
142 0.54
143 0.55
144 0.51
145 0.43
146 0.37
147 0.33
148 0.3
149 0.26
150 0.23
151 0.19
152 0.16
153 0.15
154 0.12
155 0.12
156 0.11
157 0.11
158 0.12
159 0.14
160 0.16
161 0.17
162 0.18
163 0.15
164 0.16
165 0.16
166 0.16
167 0.14
168 0.11
169 0.11
170 0.1
171 0.09
172 0.08
173 0.07
174 0.06
175 0.07
176 0.06
177 0.08
178 0.09
179 0.1
180 0.11
181 0.15
182 0.18
183 0.18
184 0.24
185 0.22
186 0.24
187 0.27
188 0.26
189 0.22
190 0.2
191 0.2
192 0.16
193 0.16
194 0.14
195 0.12
196 0.13
197 0.2
198 0.25
199 0.34
200 0.43
201 0.45
202 0.5
203 0.52
204 0.54
205 0.56
206 0.59
207 0.59
208 0.53
209 0.51
210 0.45
211 0.43
212 0.4
213 0.33
214 0.32
215 0.25
216 0.25
217 0.28
218 0.29
219 0.31
220 0.34
221 0.35
222 0.3
223 0.35
224 0.35
225 0.34
226 0.34
227 0.32
228 0.31
229 0.28
230 0.25
231 0.17
232 0.15
233 0.11
234 0.1
235 0.11
236 0.09
237 0.1
238 0.09
239 0.1
240 0.11
241 0.12
242 0.12
243 0.13
244 0.14
245 0.17