Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T8U9

Protein Details
Accession A0A2J6T8U9    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
126-151LSATRLRRLRRLRWCPSRSRIRGRSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MSQLRRTRNYHEAILLSHKVKNDQAGVHPQANGDNGSRCGNHANNNNPWAVRSRIYGQLLDVSLPAHLERYRLRGFQAGENDGLGMLFMPSLRRTSTLLHLTRCLLSKPSPQNRLSRNVAKRAIGLSATRLRRLRRLRWCPSRSRIRGRSTVPAVDQILGWDWMILFKQWSSRLVAAEREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.36
4 0.33
5 0.31
6 0.3
7 0.31
8 0.32
9 0.29
10 0.27
11 0.3
12 0.36
13 0.39
14 0.38
15 0.37
16 0.33
17 0.31
18 0.29
19 0.26
20 0.19
21 0.17
22 0.17
23 0.19
24 0.19
25 0.19
26 0.22
27 0.23
28 0.29
29 0.34
30 0.38
31 0.41
32 0.43
33 0.44
34 0.38
35 0.37
36 0.33
37 0.28
38 0.23
39 0.21
40 0.22
41 0.27
42 0.28
43 0.28
44 0.24
45 0.24
46 0.23
47 0.2
48 0.17
49 0.1
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.09
56 0.1
57 0.17
58 0.19
59 0.19
60 0.2
61 0.23
62 0.24
63 0.26
64 0.28
65 0.23
66 0.21
67 0.2
68 0.19
69 0.14
70 0.13
71 0.08
72 0.04
73 0.03
74 0.02
75 0.02
76 0.03
77 0.04
78 0.05
79 0.06
80 0.07
81 0.09
82 0.11
83 0.16
84 0.24
85 0.26
86 0.26
87 0.27
88 0.27
89 0.27
90 0.25
91 0.21
92 0.16
93 0.16
94 0.23
95 0.32
96 0.39
97 0.45
98 0.47
99 0.53
100 0.55
101 0.59
102 0.58
103 0.57
104 0.55
105 0.55
106 0.55
107 0.48
108 0.46
109 0.4
110 0.34
111 0.26
112 0.21
113 0.19
114 0.24
115 0.24
116 0.29
117 0.32
118 0.33
119 0.41
120 0.49
121 0.53
122 0.57
123 0.65
124 0.7
125 0.77
126 0.81
127 0.81
128 0.83
129 0.84
130 0.82
131 0.82
132 0.8
133 0.76
134 0.77
135 0.73
136 0.73
137 0.66
138 0.62
139 0.52
140 0.49
141 0.43
142 0.35
143 0.31
144 0.23
145 0.2
146 0.16
147 0.15
148 0.1
149 0.08
150 0.09
151 0.1
152 0.1
153 0.09
154 0.1
155 0.16
156 0.18
157 0.2
158 0.25
159 0.27
160 0.3
161 0.31