Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SVR9

Protein Details
Accession A0A2J6SVR9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
105-132ATILRALKRIKITRKKLKAEVAQRNDKLHydrophilic
NLS Segment(s)
PositionSequence
112-122KRIKITRKKLK
Subcellular Location(s) cysk 19, cyto 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
Amino Acid Sequences MPYHLTPSEIARIEDELRVAPELITPTYITQLVSNYYTSVEIIYRYRRRVNLNLPVGRRTGDAPRAITWRMEQAIKELLDHAPWFYQDEIADFLFEIFGVKVDQATILRALKRIKITRKKLKAEVAQRNDKLRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.16
4 0.16
5 0.16
6 0.15
7 0.12
8 0.12
9 0.13
10 0.13
11 0.13
12 0.12
13 0.12
14 0.13
15 0.14
16 0.12
17 0.11
18 0.11
19 0.13
20 0.13
21 0.13
22 0.11
23 0.11
24 0.11
25 0.1
26 0.1
27 0.08
28 0.08
29 0.11
30 0.2
31 0.24
32 0.28
33 0.32
34 0.36
35 0.41
36 0.46
37 0.51
38 0.52
39 0.56
40 0.57
41 0.55
42 0.52
43 0.47
44 0.4
45 0.33
46 0.25
47 0.21
48 0.2
49 0.2
50 0.2
51 0.21
52 0.23
53 0.23
54 0.21
55 0.18
56 0.16
57 0.15
58 0.15
59 0.13
60 0.12
61 0.16
62 0.15
63 0.15
64 0.14
65 0.12
66 0.12
67 0.13
68 0.11
69 0.07
70 0.08
71 0.09
72 0.08
73 0.09
74 0.08
75 0.09
76 0.11
77 0.1
78 0.1
79 0.08
80 0.08
81 0.07
82 0.06
83 0.06
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.07
91 0.06
92 0.08
93 0.11
94 0.14
95 0.15
96 0.19
97 0.22
98 0.25
99 0.34
100 0.41
101 0.48
102 0.56
103 0.65
104 0.73
105 0.8
106 0.84
107 0.83
108 0.84
109 0.83
110 0.83
111 0.83
112 0.82
113 0.82
114 0.78