Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6T201

Protein Details
Accession A0A2J6T201    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-117SSDSWRRWYRERERHRRRNARRRMREDFYDBasic
NLS Segment(s)
PositionSequence
97-111RERERHRRRNARRRM
Subcellular Location(s) extr 13, plas 6, mito 5, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPTAIALVVRRDTPLGVGVIVGVVIASLIFLLFLVVFLWWAHASHYLPTRYFYIRHPYYFPHRRRHHHTSCAVSLPSRSNNSASSSSSDSWRRWYRERERHRRRNARRRMREDFYDRGNGLGYENRYRGVLSGGVGEGWPSPRGGFGMERDLRERGLGLGVGVGSPRVGEGLGRGRNAFGLGGGLGGGLGAGLGAGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.14
4 0.11
5 0.11
6 0.09
7 0.08
8 0.08
9 0.06
10 0.03
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.06
27 0.06
28 0.07
29 0.08
30 0.11
31 0.12
32 0.15
33 0.21
34 0.22
35 0.22
36 0.24
37 0.26
38 0.25
39 0.26
40 0.27
41 0.31
42 0.32
43 0.34
44 0.34
45 0.35
46 0.44
47 0.52
48 0.55
49 0.55
50 0.6
51 0.66
52 0.73
53 0.78
54 0.76
55 0.75
56 0.74
57 0.7
58 0.64
59 0.59
60 0.51
61 0.41
62 0.35
63 0.29
64 0.27
65 0.23
66 0.22
67 0.2
68 0.21
69 0.24
70 0.24
71 0.22
72 0.2
73 0.21
74 0.21
75 0.23
76 0.25
77 0.22
78 0.27
79 0.32
80 0.34
81 0.36
82 0.45
83 0.51
84 0.59
85 0.69
86 0.73
87 0.78
88 0.84
89 0.9
90 0.91
91 0.92
92 0.92
93 0.92
94 0.92
95 0.91
96 0.9
97 0.87
98 0.8
99 0.76
100 0.72
101 0.64
102 0.56
103 0.5
104 0.41
105 0.34
106 0.29
107 0.22
108 0.17
109 0.17
110 0.16
111 0.16
112 0.16
113 0.16
114 0.16
115 0.16
116 0.15
117 0.13
118 0.11
119 0.08
120 0.09
121 0.08
122 0.08
123 0.08
124 0.08
125 0.07
126 0.08
127 0.08
128 0.07
129 0.07
130 0.07
131 0.08
132 0.09
133 0.11
134 0.12
135 0.21
136 0.23
137 0.25
138 0.27
139 0.28
140 0.27
141 0.25
142 0.23
143 0.14
144 0.12
145 0.11
146 0.08
147 0.08
148 0.07
149 0.07
150 0.07
151 0.06
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.08
159 0.17
160 0.2
161 0.22
162 0.22
163 0.22
164 0.23
165 0.24
166 0.2
167 0.11
168 0.09
169 0.07
170 0.07
171 0.06
172 0.06
173 0.04
174 0.04
175 0.04
176 0.02
177 0.02
178 0.02