Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6SU90

Protein Details
Accession A0A2J6SU90    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-78GPFWSPKRSVPRTRRQHQPRSSTRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007535  Catechol_dOase_N  
IPR015889  Intradiol_dOase_core  
Gene Ontology GO:0018576  F:catechol 1,2-dioxygenase activity  
GO:0005506  F:iron ion binding  
GO:0009712  P:catechol-containing compound metabolic process  
Pfam View protein in Pfam  
PF04444  Dioxygenase_N  
Amino Acid Sequences MMVMQFANHVAQMSTSTRHQGHRISDALGLESLVDEIAHKLLIDGANPTSSSILGPFWSPKRSVPRTRRQHQPRSSTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.2
4 0.22
5 0.25
6 0.29
7 0.31
8 0.32
9 0.34
10 0.34
11 0.3
12 0.3
13 0.27
14 0.24
15 0.18
16 0.14
17 0.09
18 0.08
19 0.06
20 0.04
21 0.04
22 0.03
23 0.03
24 0.04
25 0.04
26 0.03
27 0.03
28 0.05
29 0.05
30 0.05
31 0.06
32 0.07
33 0.07
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.06
42 0.08
43 0.12
44 0.15
45 0.18
46 0.19
47 0.25
48 0.34
49 0.43
50 0.52
51 0.58
52 0.65
53 0.74
54 0.8
55 0.85
56 0.85
57 0.87
58 0.86