Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6THY8

Protein Details
Accession A0A2J6THY8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-59LSSGGSAKGRKKRQRKEEASGLGHydrophilic
NLS Segment(s)
PositionSequence
43-52AKGRKKRQRK
Subcellular Location(s) mito 12, nucl 9, extr 5
Family & Domain DBs
Amino Acid Sequences MAPKEGAGKRPNIHTTHPQSAGSVALPLPFQTNYRSLSSGGSAKGRKKRQRKEEASGLGIGLLALSLLTVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.56
4 0.55
5 0.48
6 0.42
7 0.39
8 0.34
9 0.24
10 0.17
11 0.1
12 0.08
13 0.08
14 0.08
15 0.09
16 0.08
17 0.09
18 0.1
19 0.13
20 0.15
21 0.16
22 0.17
23 0.16
24 0.16
25 0.17
26 0.17
27 0.16
28 0.18
29 0.2
30 0.26
31 0.34
32 0.44
33 0.51
34 0.6
35 0.69
36 0.75
37 0.83
38 0.84
39 0.84
40 0.84
41 0.8
42 0.72
43 0.62
44 0.51
45 0.4
46 0.31
47 0.22
48 0.12
49 0.06
50 0.03
51 0.02