Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SUW6

Protein Details
Accession A0A2J6SUW6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-73FIAFICVKRRRRAKKRRNGQGQEDTTHydrophilic
NLS Segment(s)
PositionSequence
55-64KRRRRAKKRR
Subcellular Location(s) mito 10, cyto 5.5, cyto_nucl 5, nucl 3.5, plas 2, extr 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKSFSTSLLQSLNRRCVATDNYVCYHIPIPAVIGIVFGAAFLLLLGIFIAFICVKRRRRAKKRRNGQGQEDTTLKYLGGARPEPIPFNPNAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.39
4 0.39
5 0.41
6 0.39
7 0.36
8 0.36
9 0.37
10 0.36
11 0.33
12 0.29
13 0.21
14 0.16
15 0.11
16 0.11
17 0.09
18 0.1
19 0.08
20 0.07
21 0.06
22 0.05
23 0.05
24 0.04
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.03
37 0.03
38 0.04
39 0.09
40 0.17
41 0.21
42 0.29
43 0.4
44 0.5
45 0.62
46 0.73
47 0.79
48 0.83
49 0.89
50 0.92
51 0.94
52 0.9
53 0.89
54 0.87
55 0.8
56 0.73
57 0.64
58 0.54
59 0.44
60 0.37
61 0.27
62 0.18
63 0.18
64 0.17
65 0.21
66 0.2
67 0.21
68 0.25
69 0.27
70 0.28
71 0.27
72 0.29